DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2841 and apbb1ip

Sequence 1:NP_001284821.1 Gene:CG2841 FlyBaseID:FBgn0003159 Length:1239 Species:Drosophila melanogaster
Sequence 2:NP_001096403.1 Gene:apbb1ip XenbaseID:XB-GENE-950410 Length:658 Species:Xenopus tropicalis

Alignment Length:819 Identity:148/820 (18%)
Similarity:258/820 (31%) Gaps:310/820 (38%)


  Fly   561 EIVDEL-ATIINQQRLDTLIKKQPDPQMVEIESAKPNRLANFSITTAKSTTRIGRADSFQAGASG 624
            |.:||: :.::.:..|.|        |.:||::..|.       |.::|||.|..:..|:     
 Frog     2 EDIDEMFSNLLGEMDLLT--------QSLEIDTLPPP-------TRSESTTEINFSVGFK----- 46

  Fly   625 GGTEVASSGRALSHRSSSHVSLNKLEQNGIGLGQRRSSSELSIGESPSLQSPEVIKTILNSRKNS 689
                            ..:.|||.||.|.:                .:|.: |::..|.::.:| 
 Frog    47 ----------------DLNESLNALEDNDL----------------DALMA-ELVADITDAEQN- 77

  Fly   690 LAESGGSASTPVTEQPKIIKQLESLAKEQSSVDGVKDISSSRSEASQQSPTPVPKKSNPGVEKPT 754
            :|.....::.|.   |.:                  |.|::.:    ..|.|:|......:..|.
 Frog    78 IATYNNKSTAPF---PPV------------------DASNNYN----FQPPPIPSLIAGDLSLPP 117

  Fly   755 SPTFRAVQEPYPSSPALQKSSPAVQEQRTSPVERPSLPPAVKSVEE-----QAVSLHQ-----KE 809
            .|.  ..::.||..|....:.|..||:..|..:...:..|:..::|     :.|.:|.     |.
 Frog   118 PPP--EFEQQYPPPPHYPPTEPKTQEELESKAKTDKIKLALSKMKEAKVKKRIVKIHMTDGSTKT 180

  Fly   810 IVV---QKESPPLESMKES-----------FVIVSKMSPPAVKKVPDPFPKVEAVKEESSGNESS 860
            ::|   |.....|:::.|.           |.::.::.  ..:...|....||.:.:.:..:|::
 Frog   181 LMVDELQAVRDVLDNLFEKTHCDCSIEWSLFEVIPELQ--IERFFEDHENVVELLSDWTRDSENT 243

  Fly   861 QSTITPPNTPATPVSPVNL------------RNPNNTMAEIEQSQRDEPAPSSKPLPTTYRYSGP 913
            .:.:......|...:|.|.            .|..|.::.:|||                 :.|.
 Frog   244 INFLQKNEKYAVFKNPQNFYMARKGSADVKDMNEKNKVSLLEQS-----------------FCGA 291

  Fly   914 ----PSINFA---------TWSERPKSTVAIKNEGDYIFGGAGKSQQLTSPPSKLTIGVASPILR 965
                |.:..|         :|.:|   ...::..|.|.                           
 Frog   292 SVIVPELEAALYLKEDGKKSWKKR---YFLLRASGIYY--------------------------- 326

  Fly   966 MGIPQGKEYHVPITVKPLKD----------EILENQQQEKKEKPEVQE---LKDQEIEKESVSVK 1017
              :|:||       .|..:|          .:....|.:.|.|.....   ||..:|:|||..:|
 Frog   327 --VPKGK-------TKTSRDLACFVQFDNVNVYYGTQYKLKYKAPTDHCFVLKHPQIQKESQYIK 382

  Fly  1018 ----------------VKPKTPVKPVQKRIEKPLDQDQNSLQNHSSTLPRPAKSNRFTLPAAQ-N 1065
                            ::.....|.:.:..:..:  .:..|.:|.|||...:.|.  ...::| |
 Frog   383 YLCCEDPWVLHQWVTGIRIAKYGKVLYENYKAAV--QRGGLASHWSTLGSSSVST--AAGSSQGN 443

  Fly  1066 NQMVSHLTMNSLP-----------RPVSSLERNR--------PVEANPAPAPFGQSTLRR----- 1106
            .|:..::|..|..           :...|.|.|:        .|...|.|||...|::.|     
 Frog   444 GQICQNVTTISSSFSDAWKRGEDNKDKKSSEINKSASKSTTPTVTKRPPPAPKRASSINRGTADP 508

  Fly  1107 ----------TGFKERMLAKEQQEQEQALRIRVSVNESIPSSATAP---KSPPESKPAPP----S 1154
                      |.|...........|.....:....:|.:|  ...|   .:||:..|.||    |
 Frog   509 ACPPKPKAITTDFMPEPPQFPSPPQFPPPELPQPADEFLP--PPPPDFFDAPPDFLPPPPPSFMS 571

  Fly  1155 ISGYVALKSTKVEVKLQEPETKPVSLQVKLKPTVQPATTPSPPPPPPALQ----PVK-------- 1207
            .:|              .|...||:   :|:.:...|..|.|||||||..    |||        
 Frog   572 TAG--------------NPPPPPVT---QLQSSNGAAPPPPPPPPPPATNVPPLPVKKHPPNPPK 619

  Fly  1208 ------------TNGGRSGPTAPDPRSQLLDAIRNFKRE 1234
                        .:||..|  .||..|.|:.|::. |||
 Frog   620 RQSTMGPMPGANAHGGTGG--QPDFMSDLMKALQK-KRE 655

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2841NP_001284821.1 Ehrlichia_rpt 372..958 CDD:118064 71/447 (16%)
apbb1ipNP_001096403.1 UBQ 165..250 CDD:294102 12/87 (14%)
PH_APBB1IP 292..413 CDD:269961 22/160 (14%)
PH 303..404 CDD:278594 19/140 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3751
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.