DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: robo2 and ROBO1

Sequence 1:NP_001259868.1 Gene:robo2 FlyBaseID:FBgn0002543 Length:1519 Species:Drosophila melanogaster
Sequence 2:XP_011532278.1 Gene:ROBO1 HGNCID:10249 Length:1654 Species:Homo sapiens

Alignment Length:1503 Identity:426/1504 (28%)
Similarity:664/1504 (44%) Gaps:280/1504 (19%)


  Fly    78 NGLTQVGA-LKGEN--PRIIEHPMDTTVPKNDPFTFNCQAEGNPTPTIQWFKDGRELKTDTG--- 136
            |.|...|: |:.|:  |||:|||.|..|.|.:|.|.||:|||.|||||:|:|.|..::||..   
Human    52 NSLGYTGSRLRQEDFPPRIVEHPSDLIVSKGEPATLNCKAEGRPTPTIEWYKGGERVETDKDDPR 116

  Fly   137 SHRIMLPAGGLFFLKVIHSRR-ESDAGTYWCEAKNEFGVARSRNATLQVAFLRDEFRLEPANTRV 200
            |||::||:|.||||:::|.|: ..|.|.|.|.|:|..|.|.|.||:|:||.|||:||..|::..|
Human   117 SHRMLLPSGSLFFLRIVHGRKSRPDEGVYVCVARNYLGEAVSHNASLEVAILRDDFRQNPSDVMV 181

  Fly   201 AQGEVALMECGAPRGSPEPQISWRKNGQTLNLVGNKRIRI-VDGGNLAIQEARQSDDGRYQCVVK 264
            |.||.|:|||..|||.|||.|||:|:|..|:   :|..|| :.||.|.|...|:||.|:|.||..
Human   182 AVGEPAVMECQPPRGHPEPTISWKKDGSPLD---DKDERITIRGGKLMITYTRKSDAGKYVCVGT 243

  Fly   265 NVVGTRESATAFLKVHVRPFLIRGPQNQTAVVGSSVVFQCRIGGDPLPDVLWRRTASGGNMPLRR 329
            |:||.|||..|.|.|..||..::.|.|....|..|..|:|...|||:|.|.||:  ..|.:|..|
Human   244 NMVGERESEVAELTVLERPSFVKRPSNLAVTVDDSAEFKCEARGDPVPTVRWRK--DDGELPKSR 306

  Fly   330 VHVLEDRSLKLDDVTLEDMGEYTCEADNAVGGITATGILTVHA---PPKFVIRPKNQLVEIGDEV 391
            ..:.:|.:||:..||..|||.|||.|:|.||...|:..|||..   ||.||::|::|:|.:|..|
Human   307 YEIRDDHTLKIRKVTAGDMGSYTCVAENMVGKAEASATLTVQVGSEPPHFVVKPRDQVVALGRTV 371

  Fly   392 LFECQANGHPRPTLYWSVEGNSSLLL---PGYRDGRMEVTLTPEGRSVLSIARFAREDSGKVVTC 453
            .|:|:|.|:|:|.::|..||:.:||.   |.....|..|:.|.:    |:|....|.|.|..: |
Human   372 TFQCEATGNPQPAIFWRREGSQNLLFSYQPPQSSSRFSVSQTGD----LTITNVQRSDVGYYI-C 431

  Fly   454 NALNAVGSVSSRTVVSV-DTQFELPPPIIEQGPVNQTLPVKSIVVLPCRTLGTPVPQVSWYLDGI 517
            ..||..||:.::..:.| |...:.|||:|.|||||||:.|....||.|...|:|||.:.|..||:
Human   432 QTLNVAGSIITKAYLEVTDVIADRPPPVIRQGPVNQTVAVDGTFVLSCVATGSPVPTILWRKDGV 496

  Fly   518 PIDVQEHERRNLSDAGALTISDLQRHEDEGLYTCVASNRNGKSSWSGYLRLD---------TPTN 573
            .:..|:...:.|.: |.|.|. ..:..|.|.|||:||..:|:::||.|:.:.         .||:
Human   497 LVSTQDSRIKQLEN-GVLQIR-YAKLGDTGRYTCIASTPSGEATWSAYIEVQEFGVPVQPPRPTD 559

  Fly   574 PNIKFFRAPELSTYPGPPGKPQMVEKGENSVTLSWTRSNKVGGSSLVGYVIEMFGKNETDGWVAV 638
            ||:          .|..|.||::.:...|:||||| :.|...|::...|:||.|.......|..|
Human   560 PNL----------IPSAPSKPEVTDVSRNTVTLSW-QPNLNSGATPTSYIIEAFSHASGSSWQTV 613

  Fly   639 GTRVQNTTFTQTGLLPGVNYFFLIRAENSHGLSLPSPMSEPI-TVGTRYFNSGLDLSEARASLLS 702
            ...|:..|....||.|...|.||:||.|::|:|.||.:|:|: |......:.|:|..:.:.. |.
Human   614 AENVKTETSAIKGLKPNAIYLFLVRAANAYGISDPSQISDPVKTQDVLPTSQGVDHKQVQRE-LG 677

  Fly   703 GDVVELSNASVVDSTSMKLTWQI-INGKYVEGFYVYARQLPNPIVNNPAPVTSNTNPLLGSTSTS 766
            ..|:.|.|.:|:.|:|:::.|.: ...:|::|:.:..|                           
Human   678 NAVLHLHNPTVLSSSSIEVHWTVDQQSQYIQGYKILYR--------------------------- 715

  Fly   767 ASASASASALISTKPNIAAAGKRDGETNQSGGGAPTPLNTKYRMLTILNGGGASSCTITGLVQYT 831
                              .:|...||::.......||              ..:|..|..|.:..
Human   716 ------------------PSGANHGESDWLVFEVRTP--------------AKNSVVIPDLRKGV 748

  Fly   832 LYEFFIVPFYKSVEGKPSNSRIARTLEDVPSEAPYGMEALLL--NSSAVFLKWKAPELKDRHGVL 894
            .||....||:...:|..|..:.|:|||:.||..|.|:.....  |.:|:.:.|:.|....::|::
Human   749 NYEIKARPFFNEFQGADSEIKFAKTLEEAPSAPPQGVTVSKNDGNGTAILVSWQPPPEDTQNGMV 813

  Fly   895 LNYHVIVRGIDTAHNFSRILTNVTIDAASPTLVLANLTEGVMYTVGVAAGNNAGVGPYCVPATLR 959
            ..|.|...|.:|.::.     |.|:|.::.::|:..|..|:.|:|.|||...||.|....|..::
Human   814 QEYKVWCLGNETRYHI-----NKTVDGSTFSVVIPFLVPGIRYSVEVAASTGAGSGVKSEPQFIQ 873

  Fly   960 LDPITKRLDPFINQRYPINQDHVNDVLTQPWFIILLGAILAVLMLSFGAMVFVKRKHMMMKQSAL 1024
            ||.....:.|  ..:..:.| .::||:.||.||..:||...::::.|...::   :|...:....
Human   874 LDAHGNPVSP--EDQVSLAQ-QISDVVKQPAFIAGIGAACWIILMVFSIWLY---RHRKKRNGLT 932

  Fly  1025 NTMRGNHTSDVLKMPSLS-------ARNGNGYWLDSSTGGMVWRPSPGGDSLEMQKDHIADYAPV 1082
            :|..|     :.|:||.:       .|.|...    |:||   ||.....|....:..:||..|.
Human   933 STYAG-----IRKVPSFTFTPTVTYQRGGEAV----SSGG---RPGLLNISEPAAQPWLADTWPN 985

  Fly  1083 CGAPGSPAGGGTSSGGSGGAGSG----ASGGDDIHGGHGSERNQQRYV--------GEYSNIPTD 1135
            .|...:.......:.|:|.:.|.    :...|.|...:....|:|..:        |:. ::...
Human   986 TGNNHNDCSISCCTAGNGNSDSNLTTYSRPADCIANYNNQLDNKQTNLMLPESTVYGDV-DLSNK 1049

  Fly  1136 YAEVSSFGKAPSEYGRHGNAS--PAPYATSSILSPHQQQQQQQPRYQQRPVPGYGLQRPMH--PH 1196
            ..|:.:|.....:.||..|.|  |.||||:.::..:.......         |.|.....|  |.
Human  1050 INEMKTFNSPNLKDGRFVNPSGQPTPYATTQLIQSNLSNNMNN---------GSGDSGEKHWKPL 1105

  Fly  1197 YQQQQH---QQQQAQQTHQQHQALQQHQQLPPSNIYQQMSTTSEIYPTNTGPSRSVYSEQYYYPK 1258
            .||:|.   .|....:.::.::..:.:..:||:..|.|.      |..|||.|        |...
Human  1106 GQQKQEVAPVQYNIVEQNKLNKDYRANDTVPPTIPYNQS------YDQNTGGS--------YNSS 1156

  Fly  1259 DKQRHIHITENKLSNCHTYEAAPGAKQSSPISSQFASVRRQQLPPNCSIG-RESARFKVLNTDQG 1322
            |                        :.||...||               | ::.||...:....|
Human  1157 D------------------------RGSSTSGSQ---------------GHKKGARTPKVPKQGG 1182

  Fly  1323 KNQQNLLDLDGSSMCYNGLADSGCGGSPSPMAMLMSHEDEHALYHTADGDLDDME--------RL 1379
            .|..:||                    |.|.|....|.:... |:.:..:..|.|        |:
Human  1183 MNWADLL--------------------PPPPAHPPPHSNSEE-YNISVDESYDQEMPCPVPPARM 1226

  Fly  1380 YVKVDEQQPPQQQQQLIPLVPQHPAEGHLQSWRNQSTRSSRKNGQE--------CIKEPSELIYA 1436
            |::.||.:..:.::...|.|....:.....|:.:|||.:...:.||        |.:|...:.:.
Human  1227 YLQQDELEEEEDERGPTPPVRGAASSPAAVSYSHQSTATLTPSPQEELQPMLQDCPEETGHMQHQ 1291

  Fly  1437 PGSVASERSLLSNSGSGTSSQPAGHNVXP-----LLPGSSLGQSQSKSQSQSQSQSDLQSQEQLY 1496
            |          .......|..|....: |     .:.|..:....:.:..:.:.::|::..:.  
Human  1292 P----------DRRRQPVSPPPPPRPISPPHTYGYISGPLVSDMDTDAPEEEEDEADMEVAKM-- 1344

  Fly  1497 AREVRELL 1504
              :.|.||
Human  1345 --QTRRLL 1350

Known Domains:


GeneSequenceDomainRegion External IDIdentity
robo2NP_001259868.1 Ig1_Robo 90..185 CDD:143317 51/101 (50%)
I-set 91..184 CDD:254352 50/97 (52%)
I-set 190..279 CDD:254352 45/90 (50%)
Ig2_Robo 193..279 CDD:143201 43/87 (49%)
I-set 283..370 CDD:254352 35/87 (40%)
Ig 300..370 CDD:299845 30/70 (43%)
Ig 388..>457 CDD:299845 24/72 (33%)
I-set 479..561 CDD:254352 33/82 (40%)
Ig 496..561 CDD:143165 23/65 (35%)
FN3 588..681 CDD:238020 35/94 (37%)
FN3 <817..856 CDD:238020 10/39 (26%)
fn3 864..952 CDD:278470 25/90 (28%)
ROBO1XP_011532278.1 Ig1_Robo 67..166 CDD:143317 51/99 (52%)
I-set 68..165 CDD:254352 50/97 (52%)
I-set 172..258 CDD:254352 45/89 (51%)
Ig2_Robo 174..258 CDD:143201 43/87 (49%)
I-set 262..347 CDD:254352 35/87 (40%)
Ig3_Robo 279..347 CDD:143202 30/70 (43%)
I-set 354..448 CDD:254352 33/99 (33%)
Ig4_Robo 368..457 CDD:143203 30/94 (32%)
I-set 458..545 CDD:254352 36/89 (40%)
Ig 462..536 CDD:299845 31/76 (41%)
FN3 564..650 CDD:238020 33/87 (38%)
FN3 687..773 CDD:238020 22/145 (15%)
fn3 781..867 CDD:278470 25/91 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4222
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_128686
Panther 1 1.100 O PTHR12231
Phylome 1 0.910 0.857 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
65.770

Return to query results.
Submit another query.