DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: robo2 and Cont

Sequence 1:NP_001259868.1 Gene:robo2 FlyBaseID:FBgn0002543 Length:1519 Species:Drosophila melanogaster
Sequence 2:NP_649461.2 Gene:Cont FlyBaseID:FBgn0037240 Length:1390 Species:Drosophila melanogaster

Alignment Length:1011 Identity:229/1012 (23%)
Similarity:369/1012 (36%) Gaps:226/1012 (22%)


  Fly    91 PRIIEHPMDTT--VPKN---DPFTFNCQAEGNPTPTIQWFKDGRELKTD----------TGSHRI 140
            |..::.|.|||  |.||   :..|.:|.|.|.|||:..|:   ||:..|          ....|.
  Fly   362 PYFVKQPNDTTFDVNKNRLINDVTLSCLANGYPTPSYTWY---REVYVDDRLEYQKIDPLAQDRY 423

  Fly   141 MLPAGGLFFLKVIHSRRES-DAGTYWCEAKNEFGVARSRNATLQVAFLRDEFRLEPANTRVAQGE 204
            .:..|.|    :|:..::: |.|.|.|.|:|:||..||.:|.|...|:. ||.|:      ...|
  Fly   424 TISGGNL----IIYEPKQALDQGAYHCVAENKFGRIRSESAHL
NFGFIM-EFNLK------RSAE 477

  Fly   205 VALME------CGAPRGSPEPQISWRKNGQTLNLVGNKRIRIVDGGNLAIQEARQSDDGRYQCVV 263
            .:.|.      |..|:..|:.:..|.::.....:..::|:.:...|.|........|...|.|.|
  Fly   478 TSEMNWGKSIFCDPPQHYPDVRYYWARDYFPNFVEEDQRVFVSRDGALYFSFIETVDRANYSCTV 542

  Fly   264 KNVVGTRESATAFLKVHVRP--------FLIRGPQ--NQTAVVGSSVVFQCRIGGDPLPDVLWRR 318
            :.:|........|..:.|.|        |....|:  .:..|.|..:..:|...|.|:|...|.|
  Fly   543 QTLVSDTGRNGPFFPLR
VTPNSNYQALIFANTFPKVFPEAPVAGDEIRLECMAFGYPIPSYNWTR 607

  Fly   319 TASGGNMPLRR--VHVLEDRSLKLDDVTLEDMGEYTCEADNAVGGITATGILTVHAPPKFVIRPK 381
            .    .:||:|  ..:...|.|.:.:.|..|.|||:|...|....:..:..:.:...|:|.|..|
  Fly   608 Q----GLPLQRNAYTINYGRVLIIQNATTNDNGEYSCTITNPRKTLMKSIYINIQMRPQFTIPLK 668

  Fly   382 NQLVEIGDEVLFECQANGHPRPTLYWSVEGNSSLLLPGYRDG-RMEVTLTPEGR-----SVLSIA 440
            :.:.:...:|.|.|:|...|.....|            |::. |::.......|     :||:|.
  Fly   669 DMIKDYNSDVTFICEAFAIPDANYTW------------YKNAERLDPANINRDRYIIQDNVLTIK 721

  Fly   441 RFAREDSGKVVTCNALNAVG---SVSSRTVVSVDTQFELPPPIIEQGPV---NQTLPVKSIVVLP 499
            ...::....:..|.|.|.:.   |.:...|:|:...|:..|...|...|   |.|        :.
  Fly   722 FLEKDKDDAMYQCGAQNQLKTSFSSAQLRVLSMKPSFKKHPLESEVYAVYNGNTT--------IV 778

  Fly   500 CRTLGTPVPQVSWYLDGIPIDVQEHERRNLSDAGALTISDLQRHEDEGLYTCVASNRNG-KSSWS 563
            |.....|.|:..|..||..|....|  |.:..:|.||||...| :|||:|||:|||:.| ..|.:
  Fly   779 CDPEAAPRPKFQWKKDGQVIGSGGH--RRILPSGTLTISPTSR-DDEGIYTCIASNQAGTDESHA 840

  Fly   564 GYLRLDTPTNPNIKFFRAPELSTYPGPPGKPQMVEKGENSVTLSWTRSNKVGGSSL-VGYVIEMF 627
            ..:.|.     .|:|...|           ||.:...|:.  |.:..........| :.||.:..
  Fly   841 RVIVLQ-----EIRFIETP-----------PQRIVSKEHD--LIFLHCEAAFDELLDIAYVWKHN 887

  Fly   628 G---KNETDG-------WVAVGTRVQNTTFTQTGLLPGVNYFFLIRA-----ENSHGLSLPSPMS 677
            |   ||..||       |..:  .|.||:....|     :|..::::     .:...:|:.....
  Fly   888 GEVLKNNHDGTGRIIVDWNRL--TVHNTSMRDAG-----DYECVVKSAVNEISSKTSVSIEGAPG 945

  Fly   678 EPITVGTRYFNSGLDLSEARASLLSGDVVELSNAS----------VVDSTSMKLTWQIINGKYVE 732
            .|..|..      :.:|:.:|      ::|..:.|          ::..|:...||..::     
  Fly   946 APGGVQV------IQISKTKA------IIEWVDGSHNGRAIRYYNILGRTNWNRTWVNVS----- 993

  Fly   733 GFYVYARQLPNPIVNNPAPVTSNTNPLLGSTSTSA------SASASASALIST---KPNIAAAGK 788
             .:|.||::........|.|.:.|.......|.:|      ...::.|.:.||   ||.||    
  Fly   994 -THVQAREVDRYTSRQQAEVVNLTPWSAYEFSVTAVNDLGIGTPSAPSPIYSTYEDKPYIA---- 1053

  Fly   789 RDGETNQSGGGAP--------TPL--------NTKYRMLTILNGG--------------GASSCT 823
               ..|..|||..        .||        ...|::...|.|.              |.:...
  Fly  1054 ---PRNVGGGGGKIGDLTITWDPLLPQEQHSHGIHYKVFWKLKGAIEWASDEIKKQDHMGVAVVN 1115

  Fly   824 ITGLVQYTLYEFFIVPFYKSVEGKPSNSRIARTLEDVPSEAPYGMEALLLNSSAVFLKWKAPEL- 887
            |.....||.||..:.......:|..|...:..:.||:|..||....||..||:...:.|:..:: 
  Fly  1116 IPLNNYYTEYEVKVQAINSVGKGPESEIAVIHSAEDMPQVAPQKPIALAYNSTCFNVTWQPIDMS 1180

  Fly   888 -KDRHGVLLNYHV-----IVRGIDTAHNFSRILTNVTIDAASPTLVLANLTEGVMYTVGVAAGNN 946
             ::..|.|:.:.:     ..:..|:.:..||...|..:        :..|.....|.|.|.|.|.
  Fly  1181 RENIRGKLIGHRLKYWKTTHQEEDSVYYLSRTTRNWAL--------IVGLQPDTYYFVKVMAYNA 1237

  Fly   947 AGVGPYCVPATLRLDPITKRLDPFINQRYPINQDHV 982
            ||.|    |.:.|.:..|.|..|    :.|.:..||
  Fly  1238 AGEG----PESERFEERTYRKAP----QKPPSSVHV 1265

Known Domains:


GeneSequenceDomainRegion External IDIdentity
robo2NP_001259868.1 Ig1_Robo 90..185 CDD:143317 35/110 (32%)
I-set 91..184 CDD:254352 35/109 (32%)
I-set 190..279 CDD:254352 18/95 (19%)
Ig2_Robo 193..279 CDD:143201 16/92 (17%)
I-set 283..370 CDD:254352 23/99 (23%)
Ig 300..370 CDD:299845 18/72 (25%)
Ig 388..>457 CDD:299845 14/75 (19%)
I-set 479..561 CDD:254352 29/86 (34%)
Ig 496..561 CDD:143165 25/66 (38%)
FN3 588..681 CDD:238020 20/109 (18%)
FN3 <817..856 CDD:238020 8/53 (15%)
fn3 864..952 CDD:278470 22/95 (23%)
ContNP_649461.2 CLECT 139..>223 CDD:214480
Ig 361..460 CDD:299845 33/105 (31%)
I-set 362..462 CDD:254352 34/107 (32%)
Ig 466..559 CDD:299845 19/100 (19%)
IG_like 584..657 CDD:214653 20/77 (26%)
IGc2 586..645 CDD:197706 19/63 (30%)
Ig 667..751 CDD:299845 17/96 (18%)
IG_like 676..751 CDD:214653 16/87 (18%)
IG_like 765..844 CDD:214653 30/90 (33%)
Ig 773..844 CDD:299845 28/82 (34%)
I-set 851..940 CDD:254352 20/109 (18%)
Ig 866..944 CDD:299845 15/85 (18%)
FN3 944..1043 CDD:238020 18/117 (15%)
FN3 1053..1146 CDD:238020 18/100 (18%)
fn3 1156..1244 CDD:278470 23/100 (23%)
fn3 1259..1346 CDD:278470 3/8 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C107075119
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.