DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tollo and Tl

Sequence 1:NP_524757.1 Gene:Tollo FlyBaseID:FBgn0029114 Length:1346 Species:Drosophila melanogaster
Sequence 2:NP_001262995.1 Gene:Tl FlyBaseID:FBgn0262473 Length:1117 Species:Drosophila melanogaster

Alignment Length:1221 Identity:292/1222 (24%)
Similarity:507/1222 (41%) Gaps:294/1222 (24%)


  Fly    37 RWSGG---------GEHDITLVCHLRTINSE--------LENTNFSV-IQPQNTVRLRLECNDAL 83
            :|.|.         .|..|..:|....|.||        .||..|.: |||::.|::.....|..
  Fly    21 QWPGSEASFGRDACSEMSIDGLCQCAPIMSEYEIICPANAENPTFRLTIQPKDYVQIMCNLTDTT 85

  Fly    84 FFQSSLSPDSFRSLVELRDLTIEYCKL------GNLTDGSFRGLQELRNLTIRTHNGDWSTMSLE 142
            .:|.  .|...| :.|:..:.:..|.|      .::.|  :.|:.....|...:.|     :.:.
  Fly    86 DYQQ--LPKKLR-IGEVDRVQMRRCMLPGHTPIASILD--YLGIVSPTTLIFESDN-----LGMN 140

  Fly   143 MASNSFVEFRQLERLDLSLNNIWLIPDGMVCPLKSLQHLNASYNKIQDISNFYFSASLSSRKARV 207
            :..........|:|...:...:..||..::..:::|.||....| |:::.:..|...        
  Fly   141 ITRQHLDRLHGLKRFRFTTRRLTHIPANLLTDMRNLSHLELRAN-IEEMPSHLFDDL-------- 196

  Fly   208 CGSTLQSLDLSANKMVSLPTAMLSALGRLTHLNMAKNSMSFLADRAFEGLLSLRVVDLSANRLTS 272
              ..|:|::..:||:..:|..:...:.:|..||:..|.:..|....|||..|:..:|:..|.:..
  Fly   197 --ENLESIEFGSNKLRQMPRGIFGKMPKLKQLNLWSNQLHNLTKHDFEGATSVLGIDIHDNGIEQ 259

  Fly   273 LPPELFAETKQLQEIYLRNNSINVLAPGIFGELAELLVLDLASNELNSQWINAATFVGLKRLMML 337
            ||.::||....:.:|.|..|....|..|:|.....|..:.|.:|.:                   
  Fly   260 LPHDVFAHLTNVTDINLSANLFRSLPQGLFDHNKHLNEVRLMNNRV------------------- 305

  Fly   338 DLSANKISRLEAHIFRPLASLQILKLEDNYIDQLPGGIFADLTNLHTLILSRNRISVIEQRTLQG 402
                 .::.|.:.:|.....||||:|... :..|||.:|...|                      
  Fly   306 -----PLATLPSRLFANQPELQILRLRAE-LQSLPGDLFEHST---------------------- 342

  Fly   403 LKNLLVLSLDFNRISRMDQRSLVNCSQLQDLHLNDNKLQAVPEALAHVQL-LKTLDVGENMISQI 466
                                      |:.::.|.||.|:.:|..|...|: |.:||:..|.::.:
  Fly   343 --------------------------QITNISLGDNLLKTLPATLLEHQVNLLSLDLSNNRLTHL 381

  Fly   467 ENTSITQLESLYGLRMTENSLTHIRRGVFDRMSSLQILNLSQNKLKSIEAGSLQRNSQLQAIRLD 531
            .::......:|..||:.:|.||.|...:|..:.:|..|.:|:|:|::|::.:....:.|:.:.||
  Fly   382 PDSLFAHTTNLTDLRLEDNLLTGISGDIFSNLGNLVTLVMSRNRLRTIDSRAFVSTNGLRHLHLD 446

  Fly   532 GNQLKSIAGLFTELPNL-VWLNISGNRLEKFDYSHIPIGLQWLDVRANRITQLGNYFEIESELSL 595
            .|.:.      .:.|.| :.|....|  ..|.|.|   ||..|::|.|.|..:.|.:: .:.|.|
  Fly   447 HNDID------LQQPLLDIMLQTQIN--SPFGYMH---GLLTLNLRNNSIIFVYNDWK-NTMLQL 499

  Fly   596 STFDASYNLLTEITASSIPNSVEVLYLNDNQISKIQPYTFFKKPNLTRVDLVRNRLTTLEPNALR 660
            ...|.|||.::.:      ...::.:|:.|::          ..|:|.             |.:|
  Fly   500 RELDLSYNNISSL------GYEDLAFLSQNRL----------HVNMTH-------------NKIR 535

  Fly   661 LSPIAEDREIPEFY--------IGHNAYECDCNLDW----LQKVNRESRTQPQLMDLDQIHCRLA 713
            ...:.||..:.|.|        :..|...|||.:.|    ::.|::...::...:..|::.|...
  Fly   536 RIALPEDVHLGEGYNNNLVHVDLNDNPLVCDCTILWFIQLVRGVHKPQYSRQFKLRTDRLVCSQP 600

  Fly   714 YARGSSHVSLIEAKSDDFLCKYASHCFALCHCCDFQACDCKMECPDRCSCY---HDQSWTSNVVD 775
            .....:.|..||.::  .:|.           .||.....:.:||..|:|:   :|::.   |::
  Fly   601 NVLEGTPVRQIEPQT--LICP-----------LDFSDDPRERKCPRGCNCHVRTYDKAL---VIN 649

  Fly   776 CSRASYEQTLPSHIPMDSTQLYLDGNNFRELQSHAFIGRKRLKVLHLNHSRIEVLHNRTFYGLLE 840
            |...:.     :|:|                         ||..||.|               ::
  Fly   650 CHSGNL-----THVP-------------------------RLPNLHKN---------------MQ 669

  Fly   841 LEVLQLQSNQLKALNGNEFQGLDNLQELYLQHNAIATIDTLTF-THLYHLKILRLDHNAITSFAV 904
            |..|.|::|.|..|......|.:::..|:|..|.:.:||.... |:|.||.| ..:|..:.:..|
  Fly   670 LMELHLENNTLLRLPSANTPGYESVTSLHLAGNNLTSIDVDQLPTNLTHLDI-SWNHLQMLNATV 733

  Fly   905 WNFLPSYL--NELRLASNPWTCSCEFIDKLRDYINRHEYVVDKLKMKCDVISGNSTQQMVIYPGS 967
            ..||...:  ..::|:.|||.|.|.....|....:..|.:.|:.:|.|                 
  Fly   734 LGFLNRTMKWRSVKLSGNPWMCDCTAKPLLLFTQDNFERIGDRNEMMC----------------- 781

  Fly   968 GEPASLP--VVQCSQTLPLGLDNNFNYAEQAGGENASNATSTKMILNQPPKLDYIPILVAILTAF 1030
             ..|.:|  :|:.|       .|:...||                     |..:|.:.|.|....
  Fly   782 -VNAEMPTRMVELS-------TNDICPAE---------------------KGVFIALAVVIALTG 817

  Fly  1031 IFVMICISLVFIFRQEMRVWCHSRFGVRLFYNAQKDVDKNEREKLFDAFVSYSSKDELFVNEELA 1095
            :......:|.:.|:.|:::|.::. .:.|::..::|:||   :|.||||:|||.||:.|:.:.|.
  Fly   818 LLAGFTAALYYKFQTEIKIWLYAH-NLLLWFVTEEDLDK---DKKFDAFISYSHKDQSFIEDYLV 878

  Fly  1096 PMLEMGEHRYKLCLHQRDFPVGGYLPETIVQAIDSSRRTIMVVSENFIKSEWCRFEFKSAHQSVL 1160
            |.||.|..:::||:|:||:.|||::||.|::::..|||||:|:|:|||||||.|.||::||:|.|
  Fly   879 PQLEHGPQKFQLCVHERDWLVGGHIPENIMRSVADSRRTIIVLSQNFIKSEWARLEFRAAHRSAL 943

  Fly  1161 RDRRRRLIVIVLGEVPQKE-LDPDLRLYLKTNTYLQWGDKLFWQKLRFALP 1210
            .:.|.|:|||:..::...| ||.:|:.|||.||||:|||..||.|||||||
  Fly   944 NEGRSRIIVIIYSDIGDVEKLDEELKAYLKMNTYLKWGDPWFWDKLRFALP 994

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TolloNP_524757.1 LRR_RI <85..281 CDD:238064 40/202 (20%)
leucine-rich repeat 100..123 CDD:275380 4/29 (14%)
leucine-rich repeat 124..144 CDD:275380 2/20 (10%)
LRR_8 152..222 CDD:290566 14/70 (20%)
leucine-rich repeat 154..177 CDD:275380 4/23 (17%)
leucine-rich repeat 178..201 CDD:275380 6/23 (26%)
LRR 210..656 CDD:227223 95/448 (21%)
leucine-rich repeat 212..235 CDD:275380 5/23 (22%)
leucine-rich repeat 236..259 CDD:275380 8/23 (35%)
leucine-rich repeat 260..283 CDD:275380 6/23 (26%)
LRR_RI 276..558 CDD:238064 57/284 (20%)
leucine-rich repeat 284..307 CDD:275380 6/23 (26%)
leucine-rich repeat 308..333 CDD:275380 3/25 (12%)
leucine-rich repeat 334..357 CDD:275380 2/23 (9%)
leucine-rich repeat 358..381 CDD:275380 10/23 (43%)
leucine-rich repeat 382..405 CDD:275380 0/23 (0%)
leucine-rich repeat 406..429 CDD:275380 0/23 (0%)
leucine-rich repeat 430..452 CDD:275380 7/22 (32%)
leucine-rich repeat 453..500 CDD:275380 12/47 (26%)
leucine-rich repeat 501..521 CDD:275380 6/20 (30%)
leucine-rich repeat 525..547 CDD:275380 5/22 (23%)
leucine-rich repeat 548..573 CDD:275380 8/26 (31%)
leucine-rich repeat 604..640 CDD:275380 2/36 (6%)
leucine-rich repeat 641..688 CDD:275380 11/55 (20%)
leucine-rich repeat 689..816 CDD:275380 18/130 (14%)
LRR_8 815..875 CDD:290566 15/60 (25%)
leucine-rich repeat 817..864 CDD:275380 11/47 (23%)
LRR_8 864..921 CDD:290566 16/60 (27%)
leucine-rich repeat 865..888 CDD:275380 7/24 (29%)
leucine-rich repeat 889..910 CDD:275380 6/21 (29%)
TIR 1076..1211 CDD:214587 75/137 (55%)
TlNP_001262995.1 LRR_8 174..233 CDD:290566 15/70 (21%)
leucine-rich repeat 176..198 CDD:275380 6/33 (18%)
leucine-rich repeat 199..222 CDD:275380 5/23 (22%)
LRR_RI 216..542 CDD:238064 93/440 (21%)
LRR_8 221..281 CDD:290566 18/60 (30%)
leucine-rich repeat 223..270 CDD:275380 15/47 (32%)
leucine-rich repeat 271..294 CDD:275380 6/23 (26%)
leucine-rich repeat 295..320 CDD:275380 5/49 (10%)
leucine-rich repeat 321..343 CDD:275380 10/71 (14%)
LRR_8 342..402 CDD:290566 17/108 (16%)
leucine-rich repeat 344..367 CDD:275380 7/23 (30%)
leucine-rich repeat 368..391 CDD:275380 4/23 (17%)
LRR_8 390..450 CDD:290566 18/60 (30%)
leucine-rich repeat 392..415 CDD:275380 8/23 (35%)
leucine-rich repeat 416..439 CDD:275380 6/23 (26%)
leucine-rich repeat 440..474 CDD:275380 11/45 (24%)
leucine-rich repeat 475..498 CDD:275380 7/24 (29%)
LRR_8 477..534 CDD:290566 16/87 (18%)
leucine-rich repeat 499..520 CDD:275380 5/27 (19%)
leucine-rich repeat 523..552 CDD:275380 9/52 (17%)
LRRCT 561..619 CDD:214507 12/60 (20%)
LRRNT 631..667 CDD:214470 13/69 (19%)
leucine-rich repeat 664..693 CDD:275380 10/44 (23%)
LRR_8 669..726 CDD:290566 18/58 (31%)
leucine-rich repeat 694..715 CDD:275380 6/21 (29%)
leucine-rich repeat 716..737 CDD:275380 7/22 (32%)
LRRCT 751..800 CDD:214507 15/74 (20%)
TIR 858..996 CDD:214587 75/138 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C19479340
eggNOG 1 0.900 E2759_KOG4641
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 125 1.000 Inparanoid score I1882
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D147327at33208
OrthoFinder 1 1.000 FOG0004562
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
54.890

Return to query results.
Submit another query.