DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tollo and CG7800

Sequence 1:NP_524757.1 Gene:Tollo FlyBaseID:FBgn0029114 Length:1346 Species:Drosophila melanogaster
Sequence 2:NP_649770.1 Gene:CG7800 FlyBaseID:FBgn0037552 Length:533 Species:Drosophila melanogaster

Alignment Length:528 Identity:132/529 (25%)
Similarity:204/529 (39%) Gaps:142/529 (27%)


  Fly   228 AMLSALGRLTHLNMAKNSMSFLADRAFEGLLSLRVVDLSANRLT-----SLPPELFAETKQLQEI 287
            |.:|||||....:...:|...|..|      |....|..|.:||     |...::......|:.:
  Fly    10 ASVSALGRPDLEDYCNDSYCHLLGR------SRTFSDKKATKLTEFHMDSCEKKVLKLMPNLRTL 68

  Fly   288 YLRN--------NSINVLAPGIFGELAELLVLDLASNEL-------NSQWINAATFVGLKRLMML 337
            .|.|        |.:|        :|..|..|.|....|       .|:|.|      :|.||  
  Fly    69 ELENCDSPDFTMNDLN--------QLPYLTSLQLRRGNLLGLHDEHFSKWPN------MKILM-- 117

  Fly   338 DLSANKISRLEAHIFRPLASLQILKLEDNYIDQLPGGIFADLTNLHTLILSRNRISVIEQRTLQG 402
             |..|.|:||....|:.||.|.:|.|..|.|..||..:|.:|..|..|.||.|||..:.:....|
  Fly   118 -LGGNNITRLSNECFKGLAQLWLLSLPGNGIQGLPWDVFQNLPELLHLDLSGNRIETLHENIFTG 181

  Fly   403 LKNLLVLSLDFN-----------RISRMDQRSLVNCSQLQDLHLNDNKLQAVPEALAHVQLLKTL 456
            :..|.:|.|:.|           .:|.:....:.||..|.||.|..          ||..:|   
  Fly   182 VPKLEMLLLNGNPLTWIAPTSLKSLSNLRLLDMSNCGPLPDLSLPG----------AHTLIL--- 233

  Fly   457 DVGENMISQIENTSITQLE---SLYGLRMTENSLTHIRRGVFDRMSSLQILNLSQNKLKSIEAGS 518
                      :|:.:.:|:   |::.|:..:|.:|.|:  :.|:.|.:: |:|..|.|.:.:...
  Fly   234 ----------DNSGVQRLDILGSVHKLQARKNHITEIK--LPDKSSVIE-LDLHSNLLTATDIPK 285

  Fly   519 LQRNS-QLQAIRLDGNQLKSIAGLFTE-----------LPNLVWLNISGNRLEKFDY-SHIPIGL 570
            |.... :||.:.|..|    |.|::..           ||||:::|:|.|||.:..: |.||   
  Fly   286 LLTGMWRLQRLDLSEN----IIGIYAAAGSDNTSELFILPNLMYMNLSANRLTRLHFDSPIP--- 343

  Fly   571 QWLDVRANRITQLGNYFEIESELSLSTFDASYNLLTEITASSIPN--SVEVLYLNDNQISKIQPY 633
             |     .|:|.|               |||||.:.......|..  :::.|:|..|.|:..:..
  Fly   344 -W-----ERLTHL---------------DASYNRIYAPAKVGIDEAFNLQSLHLEGNYINNFELT 387

  Fly   634 TFFKKPNLTRVDLVRNRLTTLEPNALRLSPIAEDREIPEFY--IGHNAYECDCNLDWLQKVNRES 696
            .:...|:|..|.|..|:   .:|...        :.|.:|:  ||.|..|   ...:.|..|...
  Fly   388 PWKPHPSLKEVALYDNK---FQPKGY--------KNITKFFNEIGVNVLE---KTQYSQSNNTTP 438

  Fly   697 RTQPQLMD 704
            ..:|.:.|
  Fly   439 TCKPCIPD 446

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TolloNP_524757.1 LRR_RI <85..281 CDD:238064 15/58 (26%)
leucine-rich repeat 100..123 CDD:275380
leucine-rich repeat 124..144 CDD:275380
LRR_8 152..222 CDD:290566
leucine-rich repeat 154..177 CDD:275380
leucine-rich repeat 178..201 CDD:275380
LRR 210..656 CDD:227223 121/477 (25%)
leucine-rich repeat 212..235 CDD:275380 5/7 (71%)
leucine-rich repeat 236..259 CDD:275380 3/23 (13%)
leucine-rich repeat 260..283 CDD:275380 5/28 (18%)
LRR_RI 276..558 CDD:238064 83/323 (26%)
leucine-rich repeat 284..307 CDD:275380 6/31 (19%)
leucine-rich repeat 308..333 CDD:275380 8/32 (25%)
leucine-rich repeat 334..357 CDD:275380 10/23 (43%)
leucine-rich repeat 358..381 CDD:275380 9/23 (39%)
leucine-rich repeat 382..405 CDD:275380 8/23 (35%)
leucine-rich repeat 406..429 CDD:275380 7/34 (21%)
leucine-rich repeat 430..452 CDD:275380 6/22 (27%)
leucine-rich repeat 453..500 CDD:275380 10/50 (20%)
leucine-rich repeat 501..521 CDD:275380 5/20 (25%)
leucine-rich repeat 525..547 CDD:275380 8/33 (24%)
leucine-rich repeat 548..573 CDD:275380 10/26 (38%)
leucine-rich repeat 604..640 CDD:275380 6/38 (16%)
leucine-rich repeat 641..688 CDD:275380 11/49 (22%)
leucine-rich repeat 689..816 CDD:275380 4/17 (24%)
LRR_8 815..875 CDD:290566
leucine-rich repeat 817..864 CDD:275380
LRR_8 864..921 CDD:290566
leucine-rich repeat 865..888 CDD:275380
leucine-rich repeat 889..910 CDD:275380
TIR 1076..1211 CDD:214587
CG7800NP_649770.1 leucine-rich repeat 46..64 CDD:275380 3/18 (17%)
leucine-rich repeat 65..85 CDD:275380 5/28 (18%)
LRR_8 87..147 CDD:290566 22/69 (32%)
leucine-rich repeat 89..112 CDD:275380 6/23 (26%)
leucine-rich repeat 113..136 CDD:275380 11/26 (42%)
LRR_RI <131..334 CDD:238064 63/233 (27%)
leucine-rich repeat 137..160 CDD:275380 9/23 (39%)
LRR_8 140..195 CDD:290566 20/55 (36%)
leucine-rich repeat 161..184 CDD:275380 8/23 (35%)
leucine-rich repeat 185..208 CDD:275380 5/23 (22%)
leucine-rich repeat 209..246 CDD:275380 11/60 (18%)
leucine-rich repeat 247..267 CDD:275380 5/22 (23%)
leucine-rich repeat 268..292 CDD:275380 5/25 (20%)
leucine-rich repeat 293..322 CDD:275380 8/33 (24%)
leucine-rich repeat 395..406 CDD:275378 4/14 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C19478234
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR45617
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.