DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tollo and 18w

Sequence 1:NP_524757.1 Gene:Tollo FlyBaseID:FBgn0029114 Length:1346 Species:Drosophila melanogaster
Sequence 2:NP_476814.1 Gene:18w FlyBaseID:FBgn0004364 Length:1385 Species:Drosophila melanogaster

Alignment Length:1405 Identity:501/1406 (36%)
Similarity:774/1406 (55%) Gaps:151/1406 (11%)


  Fly     1 MLATTHMLYVL-IATCVIPIFGAALSKTVLYQAPDECRWSGGGEHDITLV---CHLRTINSELEN 61
            |.||:.::.:: :|.|::.:...|       .|..:|.|    ::.:|.:   |.:|.:.|. ..
  Fly     1 MPATSSIITIIAVAACLLLLVADA-------HAQQQCNW----QYGLTTMDIRCSVRALESG-TG 53

  Fly    62 TNFSVIQPQNTVRLRLECNDALFFQSSLSPDSFRSLVELRDLTIEYCKLGNLTDGSFRGLQELRN 126
            |...:...:...||.|:|:..|...|.|:|..||.|.:|.:|.|:.|||..:...:|.||..|:.
  Fly    54 TPLDLQVAEAAGRLDLQCSQELLHASELAPGLFRQLQKLSELRIDACKLQRVPPNAFEGLMSLKR 118

  Fly   127 LTIRTHNGDWST-MSLEMASNSFVEFRQLERLDLSLNNIWLIPDGMVCPLKSLQHLNASYNKIQD 190
            ||:.:||..|.. .:||:...||...::|..|.|..|||..:|:|:.|.:.|||.||.:.|:|:.
  Fly   119 LTLESHNAVWGPGKTLELHGQSFQGLKELSELHLGDNNIRQLPEGVWCSMPSLQLLNLTQNRIRS 183

  Fly   191 ISNFYFS------ASLSSRKARVC-GSTLQSLDLSANKMVSLPTAM-LSALGRLTHLNMAKNSMS 247
            .....||      ::||:....|. ||.||:||:|.|::.|||.|. .|.|.||..|::..|::|
  Fly   184 AEFLGFSEKLCAGSALSNANGAVSGGSELQTLDVSFNELRSLPDAWGASRLRRLQTLSLQHNNIS 248

  Fly   248 FLADRAFEGLLSLRVVDLSANRLTSLPPELFAETKQLQEIYLRNNSINVLAPGIFGELAELLVLD 312
            .||..|..||.||||:::|.|.|.|||.|.||..|:|:|::|:.|.:..|..|:...|.:|||||
  Fly   249 TLAPNALAGLSSLRVLNISYNHLVSLPSEAFAGNKELRELHLQGNDLYELPKGLLHRLEQLLVLD 313

  Fly   313 LASNELNSQWINAATFVGLKRLMMLDLSANKISRLEAHIFRPLASLQILKLEDNYIDQLPGGIFA 377
            |:.|:|.|..::.:||.||.||::|:||.|.::|:.:..|:.|..||||.:.:|.|..:..|.|.
  Fly   314 LSGNQLTSHHVDNSTFAGLIRLIVLNLSNNALTRIGSKTFKELYFLQILDMRNNSIGHIEEGAFL 378

  Fly   378 DLTNLHTLILSRNRISVIEQRTLQGLKNLLVLSLDFNRISRMDQRSLVNCSQLQDLHLNDNKLQA 442
            .|.|||||.|:.||:..::.|...||..|..|:|:.|.:|.::.::..|||.|::|.|:.|:|..
  Fly   379 PLYNLHTLNLAENRLHTLDNRIFNGLYVLTKLTLNNNLVSIVESQAFRNCSDLKELDLSSNQLTE 443

  Fly   443 VPEALAHVQLLKTLDVGENMISQIENTSITQLESLYGLRMTENSLTHIRRGVFDRMSSLQILNLS 507
            ||||:..:.:|||||:|||.||:.:|.:...|..|.|||:.:|.:.:|..|:|..:..|.:|||:
  Fly   444 VPEAVQDLSMLKTLDLGENQISEFKNNTFRNLNQLTGLRLIDNRIGNITVGMFQDLPRLSVLNLA 508

  Fly   508 QNKLKSIEAGSLQRNSQLQAIRLDGNQLKSIAGLFTELPNLVWLNISGNRLEKFDYSHIPIGLQW 572
            :|:::|||.|:..:|::::|||||.|.|..|.|:|..|.:|:|||:|.|.|..|||:.||..|:|
  Fly   509 KNRIQSIERGAFDKNTEIEAIRLDKNFLTDINGIFATLASLLWLNLSENHLVWFDYAFIPSNLKW 573

  Fly   573 LDVRANRITQLGNYFEIESELSLSTFDASYNLLTEITASSIPNSVEVLYLNDNQISKIQPYTFFK 637
            ||:..|.|..||||::::.|:.::|.|||:|.:|||.|.|:|||:|:|::|:|.|.:||..||..
  Fly   574 LDIHGNYIEALGNYYKLQEEIRVTTLDASHNRITEIGAMSVPNSIELLFINNNIIGQIQANTFVD 638

  Fly   638 KPNLTRVDLVRNRLTTLEPNALRLSPIAEDREIPEFYIGHNAYECDCNLDWLQKVNR-ESRTQPQ 701
            |..|.||||..|.|:.:..||||::|::.::.:||||:|.|.:||||:::|||::|. .:|..|.
  Fly   639 KTRLARVDLYANVLSKISLNALRVAPVSAEKPVPEFYLGGNPFECDCSMEWLQRINNLTTRQHPH 703

  Fly   702 LMDLDQIHCRLAYARGSSHVSLIEAKSDDFLCKYASHCFALCHCCDFQACDCKMECPDRCSCYHD 766
            ::||..|.|.:.::|.:....|....:.||:|||.|||...||||:::.|:|::.||..|||:||
  Fly   704 VVDLGNIECLMPHSRSAPLRPLASLSASDFVCKYESHCPPTCHCCEYEQCECEVICPGNCSCFHD 768

  Fly   767 QSWTSNVVDCSRASYEQTLPSHIPMDSTQLYLDGNNFRELQSHAFIGRKRLKVLHLNHSRIEVLH 831
            .:|.:|:|||.|... ..||:.||.|.:.|||||||..||:.....||:.|:.|:||.|.:..|.
  Fly   769 ATWATNIVDCGRQDL-AALPNRIPQDVSDLYLDGNNMPELEVGHLTGRRNLRALYLNASNLMTLQ 832

  Fly   832 NRTFYGLLELEVLQLQSNQLKALNGNEFQGLDNLQELYLQHNAIATIDTLTFTHLYHLKILRLDH 896
            |.:...|:.|.||.|::|:|.||.|.||:.|..|:||||.:|.:..|...||..|..|::||||:
  Fly   833 NGSLAQLVNLRVLHLENNKLTALEGTEFRSLGLLRELYLHNNMLTHISNATFEPLVSLEVLRLDN 897

  Fly   897 NAITSFAVWNFLPSYLNELRLASNPWTCSCEFIDKLRDYINRHEYVV-DKLKMKCDVISGNSTQQ 960
            |.::|.....:..| |..|.|..|.|:|.|:.:.:|..:::.:..|| |...:.| :.:|...:.
  Fly   898 NRLSSLPHLQYRHS-LQGLTLGRNAWSCRCQQLRELAQFVSDNAMVVRDAHDIYC-LDAGIKREL 960

  Fly   961 MVIYPGSGEPASLPVVQCSQTLPLGLDNNFNYAEQAGGENASNATSTKMILNQPPKLDYIPILVA 1025
            .:|    |..|:.|  .||..|.....|..:..:.|||..                   :|:|.|
  Fly   961 ELI----GNLANGP--DCSDLLDASASNISSSQDLAGGYR-------------------LPLLAA 1000

  Fly  1026 ILTAFIFVMICISLVFIFRQEMRVWCHSRFGVRLFYNAQKDVDKNEREKLFDAFVSYSSKDELFV 1090
            :| ..||:::.:.:||:||:.:|:|..:.:|||:.....:|..     ||:||.:.:|.||..||
  Fly  1001 VL-VLIFLVVVLIIVFVFRESVRMWLFAHYGVRVCEPRFEDAG-----KLYDAIILHSEKDYEFV 1059

  Fly  1091 NEELAPMLEMGEHRYKLCLHQRDFPVGGYLPET----IVQAIDSSRRTIMVVSENFIKSEWCRFE 1151
            ...:|..||.|...::||:.|||.|     |:.    :|:...:||:.|:|::.|.:.:||.|.|
  Fly  1060 CRNIAAELEHGRPPFRLCIQQRDLP-----PQASHLQLVEGARASRKIILVLTRNLLATEWNRIE 1119

  Fly  1152 FKSAHQSVLRDRRRRLIVIVLGEVPQKELD-PDLRLYLKT--NTYLQWGDKLFWQKLRFALPDVS 1213
            |::|....||...::|::|....|..:..| .:|..|||:  :..|...|:.||:|||:|:| :.
  Fly  1120 FRNAFHESLRGLAQKLVIIEETSVSAEAEDVAELSPYLKSVPSNRLLTCDRYFWEKLRYAIP-IE 1183

  Fly  1214 SSQRSNVAGQSCHVPINHASYHHHHH--------VHQQAMPLP-------HSVHHHQQQFMLPPP 1263
            .|.|.|          |:...||...        :.:||.|.|       ...::.......|.|
  Fly  1184 LSPRGN----------NYTLDHHERFKQPVSPGMIFRQAPPPPAYYCTEEMEANYSSATTATPSP 1238

  Fly  1264 -PQQPGSF----------RRQPSLH-------------------------QQQQQQQQIRGNNNT 1292
             |.:||..          .|.||.|                         ..|.||||:|.:.  
  Fly  1239 RPTRPGGAARIVDSMPMPMRPPSEHIYHSIESEYSAYDQHEALSMIPTGLMHQHQQQQLRLHQ-- 1301

  Fly  1293 TQQQQQQQAALLMGGGSVGGPAPQMIPLAGGIQQQSLPLP 1332
             |||||||..||.             |....:.||::|.|
  Fly  1302 -QQQQQQQQRLLQ-------------PQFRAMPQQAIPAP 1327

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TolloNP_524757.1 LRR_RI <85..281 CDD:238064 83/205 (40%)
leucine-rich repeat 100..123 CDD:275380 9/23 (39%)
leucine-rich repeat 124..144 CDD:275380 8/21 (38%)
LRR_8 152..222 CDD:290566 29/77 (38%)
leucine-rich repeat 154..177 CDD:275380 9/23 (39%)
leucine-rich repeat 178..201 CDD:275380 9/29 (31%)
LRR 210..656 CDD:227223 197/447 (44%)
leucine-rich repeat 212..235 CDD:275380 12/24 (50%)
leucine-rich repeat 236..259 CDD:275380 9/23 (39%)
leucine-rich repeat 260..283 CDD:275380 13/23 (57%)
LRR_RI 276..558 CDD:238064 117/282 (41%)
leucine-rich repeat 284..307 CDD:275380 7/23 (30%)
leucine-rich repeat 308..333 CDD:275380 13/25 (52%)
leucine-rich repeat 334..357 CDD:275380 8/23 (35%)
leucine-rich repeat 358..381 CDD:275380 9/23 (39%)
leucine-rich repeat 382..405 CDD:275380 10/23 (43%)
leucine-rich repeat 406..429 CDD:275380 8/23 (35%)
leucine-rich repeat 430..452 CDD:275380 9/22 (41%)
leucine-rich repeat 453..500 CDD:275380 20/47 (43%)
leucine-rich repeat 501..521 CDD:275380 9/20 (45%)
leucine-rich repeat 525..547 CDD:275380 11/22 (50%)
leucine-rich repeat 548..573 CDD:275380 14/25 (56%)
leucine-rich repeat 604..640 CDD:275380 18/36 (50%)
leucine-rich repeat 641..688 CDD:275380 22/47 (47%)
leucine-rich repeat 689..816 CDD:275380 54/128 (42%)
LRR_8 815..875 CDD:290566 26/60 (43%)
leucine-rich repeat 817..864 CDD:275380 20/47 (43%)
LRR_8 864..921 CDD:290566 22/57 (39%)
leucine-rich repeat 865..888 CDD:275380 10/23 (43%)
leucine-rich repeat 889..910 CDD:275380 7/21 (33%)
TIR 1076..1211 CDD:214587 49/142 (35%)
18wNP_476814.1 leucine-rich repeat 66..91 CDD:275380 11/25 (44%)
leucine-rich repeat 92..115 CDD:275380 9/23 (39%)
LRR_8 115..181 CDD:290566 25/66 (38%)
leucine-rich repeat 116..146 CDD:275380 10/30 (33%)
leucine-rich repeat 147..170 CDD:275380 9/23 (39%)
leucine-rich repeat 171..201 CDD:275380 10/30 (33%)
LRR_RI 210..464 CDD:238064 111/254 (44%)
leucine-rich repeat 212..236 CDD:275380 12/24 (50%)
LRR_8 235..295 CDD:290566 28/60 (47%)
leucine-rich repeat 237..260 CDD:275380 9/23 (39%)
leucine-rich repeat 261..284 CDD:275380 13/23 (57%)
LRR_8 283..345 CDD:290566 27/62 (44%)
leucine-rich repeat 285..308 CDD:275380 7/23 (30%)
leucine-rich repeat 309..334 CDD:275380 13/25 (52%)
LRR_8 334..393 CDD:290566 26/59 (44%)
leucine-rich repeat 335..358 CDD:275380 8/23 (35%)
leucine-rich repeat 359..382 CDD:275380 9/23 (39%)
LRR_8 382..441 CDD:290566 23/59 (39%)
leucine-rich repeat 383..406 CDD:275380 10/23 (43%)
leucine-rich repeat 407..430 CDD:275380 8/23 (35%)
LRR_8 431..488 CDD:290566 26/57 (46%)
leucine-rich repeat 431..451 CDD:275380 9/20 (45%)
leucine-rich repeat 454..477 CDD:275380 12/23 (52%)
LRR_8 477..559 CDD:290566 35/82 (43%)
leucine-rich repeat 478..499 CDD:275380 8/21 (38%)
leucine-rich repeat 502..525 CDD:275380 10/23 (43%)
leucine-rich repeat 526..548 CDD:275380 11/22 (50%)
leucine-rich repeat 590..617 CDD:275380 13/27 (48%)
leucine-rich repeat 618..641 CDD:275380 10/23 (43%)
leucine-rich repeat 642..689 CDD:275380 22/47 (47%)
LRRCT 679..736 CDD:214507 20/57 (35%)
leucine-rich repeat 775..796 CDD:275380 9/22 (41%)
LRR_8 797..852 CDD:290566 24/55 (44%)
leucine-rich repeat 797..817 CDD:275380 11/20 (55%)
leucine-rich repeat 818..841 CDD:275380 8/23 (35%)
LRR_8 841..900 CDD:290566 28/59 (47%)
leucine-rich repeat 842..865 CDD:275380 12/23 (52%)
LRR_4 866..907 CDD:289563 17/41 (41%)
leucine-rich repeat 866..889 CDD:275380 10/23 (43%)
leucine-rich repeat 890..911 CDD:275380 7/21 (33%)
TIR 1045..1183 CDD:214587 49/144 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C19478813
eggNOG 1 0.900 E2759_KOG4641
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 370 1.000 Inparanoid score I1224
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D147327at33208
OrthoFinder 1 1.000 FOG0004562
orthoMCL 1 0.900 OOG5_130303
Panther 1 1.100 P PTHR45617
RoundUp 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.