DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bem46 and acot18

DIOPT Version :10

Sequence 1:NP_477372.1 Gene:Bem46 / 44441 FlyBaseID:FBgn0025109 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001188466.1 Gene:acot18 / 556673 ZFINID:ZDB-GENE-041210-254 Length:472 Species:Danio rerio


Alignment Length:219 Identity:36/219 - (16%)
Similarity:78/219 - (35%) Gaps:51/219 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 MVEYRGYGLSTGVPTERGLVTDARAAIDYLHTRH----DLDHS------------------QLIL 183
            :||||...|::     .|.   |..|::||....    |:|.|                  ::.:
Zfish   222 LVEYRSALLAS-----HGF---ASMALEYLSPDELRTADVDVSYFENAYQILQNHPKVQKNKMAM 278

  Fly   184 FGRSLGGAVVVDVAADTVYGQKLMCAIVENT-FSSIPEMAVELVHPAVKYIPNLLFKNKYHSMSK 247
            .|.|.|.|:...:||.:...:...|..:..: ...:.:...|:.....|.:..:......|.:.:
Zfish   279 LGLSFGSAITFSMAAYSTIIKPQCCVCISGSHVVPVDKSLFEVFEEIKKNMDKVHVNEDNHVIQR 343

  Fly   248 ---------------IGKCSVPFLFISGLAD----NLVPPRMMRALYTKCGS-EIKRLLEFPGGS 292
                           :|:...|.:.::|..|    ::...:.|..:..|.|: .:..:|.:|...
Zfish   344 GMILPIPSDPAQKIDVGRIKCPVMLVNGGDDQNWASVESAQDMEMMMEKAGNRHLLTVLTYPDAG 408

  Fly   293 HNDTWIVDGYYQAIGGFLAELQQQ 316
            |........:::|....|.|::::
Zfish   409 HLIEPPYTPHFRATNFILQEMKEK 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bem46NP_477372.1 FrsA 73..312 CDD:440691 35/213 (16%)
acot18NP_001188466.1 Bile_Hydr_Trans 62..193 CDD:461422
BAAT_C 253..465 CDD:430252 25/180 (14%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.