DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mEFTu1 and TUF1

Sequence 1:NP_001163144.1 Gene:mEFTu1 FlyBaseID:FBgn0024556 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_014830.1 Gene:TUF1 SGDID:S000005713 Length:437 Species:Saccharomyces cerevisiae

Alignment Length:439 Identity:257/440 (58%)
Similarity:324/440 (74%) Gaps:14/440 (3%)


  Fly    29 SARMLRMAGATATSTACKDWQRNGLLAAPRTGNMQQYLREYANEKKVFERTKPHCNVGTIGHVDH 93
            ||.:.|:...||...:.|..:.:.:::  ||  ..|....||   ..|:|:|||.|:||||||||
Yeast     2 SALLPRLLTRTAFKASGKLLRLSSVIS--RT--FSQTTTSYA---AAFDRSKPHVNIGTIGHVDH 59

  Fly    94 GKTTLTAAITKVLADKQLAESKKYNEIDNAPEEKARGITINVAHVEYQTETRHYGHTDCPGHADY 158
            |||||||||||.||.|..|....|..||.||||:||||||:.|||||:|..|||.|.||||||||
Yeast    60 GKTTLTAAITKTLAAKGGANFLDYAAIDKAPEERARGITISTAHVEYETAKRHYSHVDCPGHADY 124

  Fly   159 IKNMITGTAQMDGAILVVAATDGAMPQTREHMLLAKQIGIDHIVVFINKVDAADE-EMVDLVEME 222
            |||||||.|||||||:|||||||.|||||||:|||:|:|:.|||||:||||..|: ||::|||||
Yeast   125 IKNMITGAAQMDGAIIVVAATDGQMPQTREHLLLARQVGVQHIVVFVNKVDTIDDPEMLELVEME 189

  Fly   223 IRELLTEMGYDGDKIPVVKGSALCALEDKSPEIGKEAILKLLQEVDSFIPTPVRELDKPFLLPVE 287
            :||||.|.|:|||..|::.||||||||.:.||||::||:|||..||.:||||.|:|:||||:|||
Yeast   190 MRELLNEYGFDGDNAPIIMGSALCALEGRQPEIGEQAIMKLLDAVDEYIPTPERDLNKPFLMPVE 254

  Fly   288 NVYSIPGRGTVVTGRLERGVVKKGMECEFVGYNKV-LKSTVTGVEMFHQILEEAQAGDQLGALVR 351
            :::||.|||||||||:|||.:|||.|.|.||:|.. ||:||||:|||.:.|:.|.|||..|.|:|
Yeast   255 DIFSISGRGTVVTGRVERGNLKKGEELEIVGHNSTPLKTTVTGIEMFRKELDSAMAGDNAGVLLR 319

  Fly   352 GVKRDDIKRGMVMCKPGSVKALDQLEAQVYILSKDEGGRTKPFMSFIQLQMFSRTWDCAVQVQIP 416
            |::||.:|||||:.|||:|||..::.|.:|||||:||||...|....:.|||.||.|..|.::.|
Yeast   320 GIRRDQLKRGMVLAKPGTVKAHTKILASLYILSKEEGGRHSGFGENYRPQMFIRTADVTVVMRFP 384

  Fly   417 ----DKEM-VMPGEDTKLILRLIRPMVLEQGQRFTLRDGNLTLGTGVVT 460
                |..| ||||::.::...||.|..||.||||.:|:|..|:|||::|
Yeast   385 KEVEDHSMQVMPGDNVEMECDLIHPTPLEVGQRFNIREGGRTVGTGLIT 433

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mEFTu1NP_001163144.1 PRK00049 73..463 CDD:234596 246/396 (62%)
EF_Tu 81..274 CDD:206671 139/194 (72%)
EFTU_II 282..368 CDD:293898 54/87 (62%)
mtEFTU_III 371..462 CDD:294005 43/96 (45%)
TUF1NP_014830.1 PRK00049 40..437 CDD:234596 246/395 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C166413888
eggNOG 1 0.900 E1_COG0050
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H2490
Inparanoid 1 1.050 490 1.000 Inparanoid score I215
Isobase 1 0.950 0 Normalized mean entropy S366
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003422
OrthoInspector 1 1.000 T1135523
orthoMCL 1 0.900 OOG5_126954
Panther 1 1.100 LDO PTHR43721
Phylome 1 0.910 0.605 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R370
TreeFam 1 0.960
1312.740

Return to query results.
Submit another query.