DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mEFTu1 and AT4G02930

Sequence 1:NP_001163144.1 Gene:mEFTu1 FlyBaseID:FBgn0024556 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_192202.1 Gene:AT4G02930 AraportID:AT4G02930 Length:454 Species:Arabidopsis thaliana

Alignment Length:463 Identity:246/464 (53%)
Similarity:325/464 (70%) Gaps:16/464 (3%)


  Fly     6 AAAVCRSTASMSLALRCSRRAMSSARMLRMAGATATSTACKDWQRNGLLAAPRTGNMQQYLREYA 70
            |:.|.|:.:|       .|....|:::....||:.||:........|...:..|.....:.|..|
plant     2 ASVVLRNPSS-------KRLVPFSSQIYSRCGASVTSSYSISHSIGGDDLSSSTFGTSSFWRSMA 59

  Fly    71 NEKKVFERTKPHCNVGTIGHVDHGKTTLTAAITKVLADKQLAESKKYNEIDNAPEEKARGITINV 135
                .|.|.|||.||||||||||||||||||||||||::..|::..::|||.|||||.|||||..
plant    60 ----TFTRNKPHVNVGTIGHVDHGKTTLTAAITKVLAEEGKAKAIAFDEIDKAPEEKKRGITIAT 120

  Fly   136 AHVEYQTETRHYGHTDCPGHADYIKNMITGTAQMDGAILVVAATDGAMPQTREHMLLAKQIGIDH 200
            |||||:|..|||.|.||||||||:||||||.|||||.||||:..||.||||:||:|||:|:|:..
plant   121 AHVEYETAKRHYAHVDCPGHADYVKNMITGAAQMDGGILVVSGPDGPMPQTKEHILLARQVGVPS 185

  Fly   201 IVVFINKVDAADE-EMVDLVEMEIRELLTEMGYDGDKIPVVKGSALCALEDKSPEIGKEAILKLL 264
            :|.|:||||..|: |:::|||||:||||:...:.||.||:::||||.||:..:.|||::|||||:
plant   186 LVCFLNKVDVVDDPELLELVEMELRELLSFYKFPGDDIPIIRGSALSALQGTNDEIGRQAILKLM 250

  Fly   265 QEVDSFIPTPVRELDKPFLLPVENVYSIPGRGTVVTGRLERGVVKKGMECEFVGYNK---VLKST 326
            ..||.:||.|||.||||||:|:|:|:||.|||||.|||:|:||:|.|.|.|.:|..:   .||||
plant   251 DAVDEYIPDPVRVLDKPFLMPIEDVFSIQGRGTVATGRIEQGVIKVGEEVEILGLREGGVPLKST 315

  Fly   327 VTGVEMFHQILEEAQAGDQLGALVRGVKRDDIKRGMVMCKPGSVKALDQLEAQVYILSKDEGGRT 391
            |||||||.:||:..||||.:|.|:||:||:||:||||:.||||.|...:.||::|:|:||||||.
plant   316 VTGVEMFKKILDNGQAGDNVGLLLRGLKREDIQRGMVIAKPGSCKTYKKFEAEIYVLTKDEGGRH 380

  Fly   392 KPFMSFIQLQMFSRTWDCAVQVQIPDK-EMVMPGEDTKLILRLIRPMVLEQGQRFTLRDGNLTLG 455
            ..|.|..:.|.:.||.|...:|::|:. :|||||::...:..||.|:.||.||||.||:|..|:|
plant   381 TAFFSNYRPQFYLRTADITGKVELPENVKMVMPGDNVTAVFELIMPVPLETGQRFALREGGRTVG 445

  Fly   456 TGVVTSTL 463
            .|||:..:
plant   446 AGVVSKVM 453

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mEFTu1NP_001163144.1 PRK00049 73..463 CDD:234596 232/395 (59%)
EF_Tu 81..274 CDD:206671 125/194 (64%)
EFTU_II 282..368 CDD:293898 54/89 (61%)
mtEFTU_III 371..462 CDD:294005 41/92 (45%)
AT4G02930NP_192202.1 PLN03127 1..454 CDD:178673 246/464 (53%)
EF_Tu 66..260 CDD:206671 125/194 (64%)
EFTU_II 268..357 CDD:293898 54/89 (61%)
EFTU_III 360..449 CDD:294006 40/89 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H2490
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D491836at2759
OrthoInspector 1 1.000 T32300
orthoMCL 1 0.900 OOG5_126954
Panther 1 1.100 LDO PTHR43721
Phylome 1 0.910 0.613 Consistency score
87.930

Return to query results.
Submit another query.