DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mEFTu1 and RABE1b

Sequence 1:NP_001163144.1 Gene:mEFTu1 FlyBaseID:FBgn0024556 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_001329775.1 Gene:RABE1b AraportID:AT4G20360 Length:476 Species:Arabidopsis thaliana

Alignment Length:487 Identity:236/488 (48%)
Similarity:320/488 (66%) Gaps:45/488 (9%)


  Fly     6 AAAVCRSTA-----------SMSLALRCSRRAMS---SARMLRMAGATATSTACKDWQRNGLLAA 56
            |.|.|.|::           |:..|:..|.:..:   |:..|.....|.|| |.:..:|:..:.|
plant     5 APAACSSSSRILCSYSSPSPSLCPAISTSGKLKTLTLSSSFLPSYSLTTTS-ASQSTRRSFTVRA 68

  Fly    57 PRTGNMQQYLREYANEKKVFERTKPHCNVGTIGHVDHGKTTLTAAITKVLADKQLAESKKYNEID 121
            .| |.              |||.|||.|:||||||||||||||||:|..||....:.:|||:|||
plant    69 AR-GK--------------FERKKPHVNIGTIGHVDHGKTTLTAALTMALASIGSSVAKKYDEID 118

  Fly   122 NAPEEKARGITINVAHVEYQTETRHYGHTDCPGHADYIKNMITGTAQMDGAILVVAATDGAMPQT 186
            .||||:|||||||.|.|||:||.|||.|.||||||||:||||||.||||||||||:..||.||||
plant   119 AAPEERARGITINTATVEYETENRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSGADGPMPQT 183

  Fly   187 REHMLLAKQIGIDHIVVFINKVDAADE-EMVDLVEMEIRELLTEMGYDGDKIPVVKGSALCALE- 249
            :||:|||||:|:..:|||:||.|..|: |:::|||:|:||||:...::||.||::.||||.|:| 
plant   184 KEHILLAKQVGVPDMVVFLNKEDQVDDAELLELVELEVRELLSSYEFNGDDIPIISGSALLAVET 248

  Fly   250 -DKSPEIGK------EAILKLLQEVDSFIPTPVRELDKPFLLPVENVYSIPGRGTVVTGRLERGV 307
             .::|::.:      :.|.:|:..||.:||.|.|:.:.||||.||:|:||.|||||.|||:|||.
plant   249 LTENPKVKRGDNKWVDKIYELMDAVDDYIPIPQRQTELPFLLAVEDVFSITGRGTVATGRVERGT 313

  Fly   308 VKKGMECEFVGYNKVLKSTVTGVEMFHQILEEAQAGDQLGALVRGVKRDDIKRGMVMCKPGSVKA 372
            ||.|...:.||..:....||||||||.:||:||.|||.:|.|:||:::.||:||||:.||||:..
plant   314 VKVGETVDLVGLRETRSYTVTGVEMFQKILDEALAGDNVGLLLRGIQKADIQRGMVLAKPGSITP 378

  Fly   373 LDQLEAQVYILSKDEGGRTKPFMSFIQLQMFSRTWDCAVQVQ--IPDKE----MVMPGEDTKLIL 431
            ..:.||.:|:|.|:||||..||.:..:.|.:.||.|...:|.  :.||:    |||||:..|:::
plant   379 HTKFEAIIYVLKKEEGGRHSPFFAGYRPQFYMRTTDVTGKVTKIMNDKDEESKMVMPGDRVKIVV 443

  Fly   432 RLIRPMVLEQGQRFTLRDGNLTLGTGVVTSTL 463
            .||.|:..|||.||.:|:|..|:|.||:.:.|
plant   444 ELIVPVACEQGMRFAIREGGKTVGAGVIGTIL 475

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mEFTu1NP_001163144.1 PRK00049 73..463 CDD:234596 218/405 (54%)
EF_Tu 81..274 CDD:206671 120/202 (59%)
EFTU_II 282..368 CDD:293898 51/86 (59%)
mtEFTU_III 371..462 CDD:294005 38/97 (39%)
RABE1bNP_001329775.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 429 1.000 Inparanoid score I407
OMA 1 1.010
OrthoDB 1 1.010 D491836at2759
OrthoInspector 1 1.000 T32300
orthoMCL 1 0.900 OOG5_126954
Panther 1 1.100 O PTHR43721
Phylome 1 0.910 0.667 Consistency score
76.980

Return to query results.
Submit another query.