DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mEFTu1 and TUFM

Sequence 1:NP_001163144.1 Gene:mEFTu1 FlyBaseID:FBgn0024556 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_003312.3 Gene:TUFM HGNCID:12420 Length:455 Species:Homo sapiens

Alignment Length:449 Identity:280/450 (62%)
Similarity:353/450 (78%) Gaps:4/450 (1%)


  Fly    27 MSSARMLRMAGATATSTACKDWQRNGLLAAPRTGNMQQYLREYANE-KKVFERTKPHCNVGTIGH 90
            |::|.:||.....:...|.:.:...|||...:...:....|..|.| ||.:.|.|||.|||||||
Human     4 MAAATLLRATPHFSGLAAGRTFLLQGLLRLLKAPALPLLCRGLAVEAKKTYVRDKPHVNVGTIGH 68

  Fly    91 VDHGKTTLTAAITKVLADKQLAESKKYNEIDNAPEEKARGITINVAHVEYQTETRHYGHTDCPGH 155
            ||||||||||||||:||:...|:.|||.||||||||:|||||||.|||||.|..|||.|||||||
Human    69 VDHGKTTLTAAITKILAEGGGAKFKKYEEIDNAPEERARGITINAAHVEYSTAARHYAHTDCPGH 133

  Fly   156 ADYIKNMITGTAQMDGAILVVAATDGAMPQTREHMLLAKQIGIDHIVVFINKVDAA-DEEMVDLV 219
            |||:||||||||.:||.||||||.||.|||||||:|||:|||::|:||::||.||. |.|||:||
Human   134 ADYVKNMITGTAPLDGCILVVAANDGPMPQTREHLLLARQIGVEHVVVYVNKADAVQDSEMVELV 198

  Fly   220 EMEIRELLTEMGYDGDKIPVVKGSALCALEDKSPEIGKEAILKLLQEVDSFIPTPVRELDKPFLL 284
            |:||||||||.||.|::.||:.||||||||.:.||:|.:::.|||..||::||.|.|:|:|||||
Human   199 ELEIRELLTEFGYKGEETPVIVGSALCALEGRDPELGLKSVQKLLDAVDTYIPVPARDLEKPFLL 263

  Fly   285 PVENVYSIPGRGTVVTGRLERGVVKKGMECEFVGYNKVLKSTVTGVEMFHQILEEAQAGDQLGAL 349
            |||.|||:|||||||||.||||::|||.|||.:|::|.:::.|||:||||:.||.|:|||.||||
Human   264 PVEAVYSVPGRGTVVTGTLERGILKKGDECELLGHSKNIRTVVTGIEMFHKSLERAEAGDNLGAL 328

  Fly   350 VRGVKRDDIKRGMVMCKPGSVKALDQLEAQVYILSKDEGGRTKPFMSFIQLQMFSRTWDCAVQVQ 414
            |||:||:|::||:||.||||:|...::|||||||||:||||.|||:|.....|||.|||.|.::.
Human   329 VRGLKREDLRRGLVMVKPGSIKPHQKVEAQVYILSKEEGGRHKPFVSHFMPVMFSLTWDMACRII 393

  Fly   415 I-PDKEMVMPGEDTKLILRLIRPMVLEQGQRFTLRDGNLTLGTGVVTSTLPPLTESQRS 472
            : |:||:.|||||.|..|.|.:||:||:||||||||||.|:|||:||:|| .:||.:::
Human   394 LPPEKELAMPGEDLKFNLILRQPMILEKGQRFTLRDGNRTIGTGLVTNTL-AMTEEEKN 451

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mEFTu1NP_001163144.1 PRK00049 73..463 CDD:234596 266/392 (68%)
EF_Tu 81..274 CDD:206671 139/194 (72%)
EFTU_II 282..368 CDD:293898 59/86 (69%)
mtEFTU_III 371..462 CDD:294005 56/92 (61%)
TUFMNP_003312.3 SelB 50..444 CDD:332589 267/395 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0050
Hieranoid 1 1.000
Homologene 1 1.000 H2490
Inparanoid 1 1.050 561 1.000 Inparanoid score I1078
Isobase 1 0.950 0 Normalized mean entropy S366
OMA 1 1.010
OrthoDB 1 1.010 D298219at33208
OrthoFinder 1 1.000 FOG0003422
OrthoInspector 1 1.000 T1072224
orthoMCL 1 0.900 OOG5_126954
Panther 1 1.100 LDO PTHR43721
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R370
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1312.860

Return to query results.
Submit another query.