DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mEFTu1 and tufm

Sequence 1:NP_001163144.1 Gene:mEFTu1 FlyBaseID:FBgn0024556 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_001013523.1 Gene:tufm ZFINID:ZDB-GENE-050320-73 Length:448 Species:Danio rerio

Alignment Length:465 Identity:290/466 (62%)
Similarity:355/466 (76%) Gaps:20/466 (4%)


  Fly    18 LALRCSRRAMSSARMLRMAGATATSTACKDWQRNGLLAAPRTGNMQQYLREYANE-KKVFERTKP 81
            :|...|.||..||  |::...:...::.|      |.|.|.:      .|.:|.| ||||.|.||
Zfish     1 MAALVSVRACLSA--LQLTSPSLLHSSFK------LCAVPLS------RRNFAAEAKKVFARDKP 51

  Fly    82 HCNVGTIGHVDHGKTTLTAAITKVLADKQLAESKKYNEIDNAPEEKARGITINVAHVEYQTETRH 146
            |.|:||||||||||||||||||||||:...|..|.|.:|||||||||||||||.:||||.|..||
Zfish    52 HLNIGTIGHVDHGKTTLTAAITKVLAEAGGANYKSYEDIDNAPEEKARGITINASHVEYTTANRH 116

  Fly   147 YGHTDCPGHADYIKNMITGTAQMDGAILVVAATDGAMPQTREHMLLAKQIGIDHIVVFINKVDAA 211
            |.||||||||||:||||||||||||.|||||||||.|||||||:|||:|||:.|:||:|||.||.
Zfish   117 YAHTDCPGHADYVKNMITGTAQMDGCILVVAATDGQMPQTREHLLLARQIGVQHVVVYINKADAV 181

  Fly   212 DE-EMVDLVEMEIRELLTEMGYDGDKIPVVKGSALCALEDKSPEIGKEAILKLLQEVDSFIPTPV 275
            |: ||:||||:||||||||.||||:..|||.||||||||:|.||:|..:|:|||:.:|..||.|.
Zfish   182 DDKEMLDLVELEIRELLTEFGYDGENTPVVVGSALCALENKKPELGVNSIMKLLEVIDGHIPLPS 246

  Fly   276 RELDKPFLLPVENVYSIPGRGTVVTGRLERGVVKKGMECEFVGYNKVLKSTVTGVEMFHQILEEA 340
            |:||||||:||:.|||||||||||:|.|||||:|||.||||:|:|:..||.:||:||||:.|:.|
Zfish   247 RDLDKPFLMPVDGVYSIPGRGTVVSGTLERGVIKKGDECEFLGHNRCFKSIITGIEMFHKSLDRA 311

  Fly   341 QAGDQLGALVRGVKRDDIKRGMVMCKPGSVKALDQLEAQVYILSKDEGGRTKPFMSFIQLQMFSR 405
            :|||.:|||:||:||:|::|||||.||||::...::.||||||||:||||.|||.:.....|||.
Zfish   312 EAGDNMGALIRGLKREDVRRGMVMIKPGSIQPHQKIRAQVYILSKEEGGRHKPFFTNFTPIMFSL 376

  Fly   406 TWDCAVQVQ-IPDKEMVMPGEDTKLILRLIRPMVLEQGQRFTLRDGNLTLGTGVVTSTLPPLTES 469
            |||.|..|: :|.||||||||||.:.|.|.:||.|::||||||||||.|:|||:||..   ||.:
Zfish   377 TWDMACIVELLPGKEMVMPGEDTAVNLILRQPMALDKGQRFTLRDGNQTIGTGLVTDI---LTIT 438

  Fly   470 QRSELTEGKK 479
            :..:.|.|:|
Zfish   439 KDDKYTWGEK 448

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mEFTu1NP_001163144.1 PRK00049 73..463 CDD:234596 271/392 (69%)
EF_Tu 81..274 CDD:206671 144/194 (74%)
EFTU_II 282..368 CDD:293898 58/86 (67%)
mtEFTU_III 371..462 CDD:294005 55/92 (60%)
tufmNP_001013523.1 PRK00049 42..435 CDD:234596 271/396 (68%)
EF_Tu 51..245 CDD:206671 144/194 (74%)
EFTU_II 253..339 CDD:293898 58/86 (67%)
mtEFTU_III 342..434 CDD:294005 55/92 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C166405284
eggNOG 1 0.900 E1_COG0050
Hieranoid 1 1.000
Homologene 1 1.000 H2490
Inparanoid 1 1.050 562 1.000 Inparanoid score I1035
OMA 1 1.010
OrthoDB 1 1.010 D298219at33208
OrthoFinder 1 1.000 FOG0003422
OrthoInspector 1 1.000 T1051680
orthoMCL 1 0.900 OOG5_126954
Panther 1 1.100 LDO PTHR43721
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R370
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1312.840

Return to query results.
Submit another query.