DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mEFTu1 and CG4849

Sequence 1:NP_001163144.1 Gene:mEFTu1 FlyBaseID:FBgn0024556 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_651605.1 Gene:CG4849 FlyBaseID:FBgn0039566 Length:975 Species:Drosophila melanogaster

Alignment Length:468 Identity:102/469 (22%)
Similarity:168/469 (36%) Gaps:120/469 (26%)


  Fly    84 NVGTIGHVDHGKTT-LTAAITKVLADKQLAESKKYNEIDNAPEEKARGITIN---VAHVEYQTET 144
            ||..:||:.||||| :...|.:.....:..|.::....|....|:.||.:|.   |..|....:.
  Fly   133 NVALVGHLHHGKTTFVDCLIRQTHPQFETMEERQLRYTDTLFTEQERGCSIKATPVTLVLQDVKQ 197

  Fly   145 RHY--GHTDCPGHADYIKNMITGTAQMDGAILVVAATDGAMPQTR---EHMLLAKQIGIDHIVVF 204
            :.|  ...|.|||.::...........||.:|.:.|.:|.|..|.   :|.:..:|.    |.|.
  Fly   198 KSYLLNIFDTPGHVNFSDEATAAMRMSDGVVLFIDAAEGVMLNTERLLKHAVQERQA----ITVC 258

  Fly   205 INKVDA-----------ADEEMVDLVEMEIRELLTEMGYDGDKIPVVKGSALCALEDKSPEIGK- 257
            |||:|.           |..::..:|| |:..||:..|...|.:.|            ||.:|. 
  Fly   259 INKIDRLILELKLPPQDAYFKLKHIVE-EVNGLLSTYGAPDDNLLV------------SPILGNV 310

  Fly   258 -------------EAILKLLQEV---------------DSFIPTPVRELDK------------PF 282
                         ::..||..:.               |.:..:..|:..|            .|
  Fly   311 CFASSLYGFCFTLKSFAKLYADTYEGVAYLDFAKRLWGDMYFNSKTRKFSKKQPHNSAQRSFVEF 375

  Fly   283 LLPVENVYSIPGR--GTVVT------GRLERGVVKKGMECEFVGYNKVLKSTVTG---------V 330
            :|  |.:|.:..:  |.|.|      ..|...|.|:.|:.......:::.:...|         |
  Fly   376 IL--EPMYKLIAQVVGDVDTTLSDTLAELNVRVSKEEMKSNIRPLLRLVCNRFMGDCSGFVDMCV 438

  Fly   331 EMFHQILEEAQAGDQLGALVRGVKRDDIKRGMVMCKPGSVKALDQLEAQVYILSKDEGGRTKPFM 395
            |.....||.|:.  ::..:..|.|..||.|.|:.|  .....|....:::|  ..|:       .
  Fly   439 EHIKSPLENAKR--KVDHIYTGPKEGDIYRDMISC--NQYGTLMVHSSKMY--PNDD-------C 490

  Fly   396 SFIQL--QMFSRTWDCAVQVQIPDKEMVMPGEDTKLILRLIRPMVLEQGQRFTLR---DGNLTLG 455
            :|.|:  ::.|.|.....:|::..:...:..|:...||::.|..|.|...:..|.   .||..|.
  Fly   491 TFFQVLARIVSGTLHAGQEVRVLGENYTLQDEEDSRILQVGRLWVFESRYKVELNRVPAGNWVLI 555

  Fly   456 TG-----VVTSTL 463
            .|     |.|||:
  Fly   556 EGIDQCIVKTSTI 568

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mEFTu1NP_001163144.1 PRK00049 73..463 CDD:234596 102/467 (22%)
EF_Tu 81..274 CDD:206671 53/239 (22%)
EFTU_II 282..368 CDD:293898 24/103 (23%)
mtEFTU_III 371..462 CDD:294005 22/101 (22%)
CG4849NP_651605.1 EFTUD2 4..111 CDD:292623
PTZ00416 115..957 CDD:240409 102/469 (22%)
Snu114p 132..340 CDD:206730 52/224 (23%)
Translation_Factor_II_like 477..568 CDD:295476 23/100 (23%)
snRNP_III 589..660 CDD:293921
EF2_IV_snRNP 660..837 CDD:238840
eEF2_C_snRNP 832..911 CDD:239765
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C86325263
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.