DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mEFTu1 and mRRF2

Sequence 1:NP_001163144.1 Gene:mEFTu1 FlyBaseID:FBgn0024556 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_732771.2 Gene:mRRF2 FlyBaseID:FBgn0051159 Length:740 Species:Drosophila melanogaster

Alignment Length:672 Identity:126/673 (19%)
Similarity:199/673 (30%) Gaps:311/673 (46%)


  Fly    48 WQRNGLLAAPRTGNM-------QQYLREYANEKKVFERTKPHCNVGTIGHVDHGKTTLT------ 99
            ||     :.|:..|.       |.:.|.|:::.:         |:|.:.|:|.||||.|      
  Fly     6 WQ-----SGPKQSNRWLWHLSNQIWKRSYSSKIR---------NIGILAHIDAGKTTTTERMLFY 56

  Fly   100 AAITKVLADKQLAESKKYNEI-DNAPEEKARGITINVAHVEYQTETRHYGHTDCPGHADYIKNMI 163
            |..|:.     |.|..:.|.: |...:|:.|||||..:.|.:..........|.|||.|:...:.
  Fly    57 AGKTRA-----LGEVHRGNTVTDYLTQERERGITICSSAVTFSWNDHRINLLDTPGHIDFTMEVE 116

  Fly   164 TGTAQMDGAILVVAATDGAMPQT-------REHMLLAKQIGIDHIVVFINKVD------------ 209
            .....:||.::|:..|.|...||       .:|.|..        ::|:||:|            
  Fly   117 QSLYAVDGVVVVLDGTAGVEAQTVTVWSQADKHKLPR--------LIFVNKMDRPDADFEKCVSD 173

  Fly   210 ----------------------------------------------------------------- 209
                                                                             
  Fly   174 LKDKLETQPVCLQYPVKNEDGVLAINDVITLERLSWQQKDLGRSYRNVKLEPSDDLRLLQEKRNE 238

  Fly   210 ------AADEEMVD--------------LVEMEIRELLTEMGYDGDKIPVVKGSALCALEDKSPE 254
                  ..|:|:.|              |:|..:|...|:.    ..:||:.|||.       ..
  Fly   239 LIDQLSGLDDELADVVISTESFDNVDNALIERALRRATTQQ----KVVPVLLGSAY-------KN 292

  Fly   255 IGKEAILKLLQEVDSFIPTPVRELDKPFLLPVENVYSIPG---------------RGTVVTGRLE 304
            :|   |.:|:..|::::|.|...         ..:|...|               ||.:...|:.
  Fly   293 VG---IQRLMDAVNAYLPAPEER---------NQIYDCFGTEVAGKVFKIVHDKQRGPLTLVRIL 345

  Fly   305 RGVVKKGM-------ECEFVG---------YNKV-------------LKSTVTG--VEMFHQILE 338
            ||.:|:||       :.|.|.         |.:|             |||||||  :......|:
  Fly   346 RGEIKRGMRLISARGQAEVVSKLYEPLADEYREVSAVQSGDVVICAGLKSTVTGDLLTSSQSALK 410

  Fly   339 EAQA--GDQLGALVRGVKRDD--------------IKRGMVMC--KPGSVKALDQLEAQVYILSK 385
            .||.  ...||.....|:.||              |...:..|  :|.||.:...:|..:..|.:
  Fly   411 NAQKRYKQSLGNTAAKVEEDDELDESDELFAIDPQIPDAVYFCSIEPPSVSSQTAMEQALKQLQR 475

  Fly   386 DE----------------GGRTKPFMSFIQLQMFSRTWDCAVQV-----QIPDKEMV-MPGEDTK 428
            ::                ||..:..|..|:.::.|   :..:.|     ||..||.: .|...|.
  Fly   476 EDPSLRVSYDSVTGQTVLGGMGELHMDIIKSRILS---EYKIDVDLGPLQIAYKETIEAPALTTL 537

  Fly   429 LI------------------------------------LRLIRPMV-----------LEQGQRF- 445
            .:                                    |..:||.:           ||:|.|. 
  Fly   538 SVEKEIAGSKQSVSITLEVVKNQAELFSLDKSPDNLPNLNTLRPRILQVLRKGSISALERGPRVG 602

  Fly   446 ------TLRDGNLTLGTGVVTS 461
                  .:|..|.|:|.|...|
  Fly   603 GQVVETQIRLHNATIGRGTADS 624

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mEFTu1NP_001163144.1 PRK00049 73..463 CDD:234596 119/641 (19%)
EF_Tu 81..274 CDD:206671 57/304 (19%)
EFTU_II 282..368 CDD:293898 32/150 (21%)
mtEFTU_III 371..462 CDD:294005 27/168 (16%)
mRRF2NP_732771.2 PRK12739 31..733 CDD:237185 119/643 (19%)
P-loop_NTPase 35..309 CDD:304359 57/301 (19%)
Translation_Factor_II_like 323..403 CDD:295476 19/80 (24%)
EFG_III 447..522 CDD:293919 12/78 (15%)
mtEFG2_like_IV 523..642 CDD:238842 18/103 (17%)
EFG_mtEFG_C 647..724 CDD:239683
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C87727366
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.