DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mEFTu1 and eIF2gamma

Sequence 1:NP_001163144.1 Gene:mEFTu1 FlyBaseID:FBgn0024556 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_001262587.1 Gene:eIF2gamma FlyBaseID:FBgn0263740 Length:475 Species:Drosophila melanogaster

Alignment Length:461 Identity:115/462 (25%)
Similarity:183/462 (40%) Gaps:105/462 (23%)


  Fly    84 NVGTIGHVDHGKTTLTAAITKVLADKQLAESKKYNEIDNAPEEKARGITINVAHVE---YQTE-- 143
            |:||||||.|||:|:..||:.|    |....|  ||::       |.|||.:.:..   |:.:  
  Fly    42 NIGTIGHVAHGKSTVVKAISGV----QTVRFK--NELE-------RNITIKLGYANAKIYKCDNP 93

  Fly   144 --------------------------------TRHYGHTDCPGHADYIKNMITGTAQMDGAILVV 176
                                            .||....|||||...:..|:.|.|.||.|:|::
  Fly    94 KCPRPASFVSDASSKDDSLPCTRLNCSGNFRLVRHVSFVDCPGHDILMATMLNGAAVMDAALLLI 158

  Fly   177 AATDGA-MPQTREHMLLAKQIGIDHIVVFINKVDAADEEMVDLVEMEIRELLTEMGYDGDKIPVV 240
            |..:.. .|||.||:...:.:.:..|::..||:|...|........||.:.:  .|...:..|::
  Fly   159 AGNESCPQPQTSEHLAAIEIMKLKQILILQNKIDLIKESQAKEQYEEITKFV--QGTVAEGAPII 221

  Fly   241 KGSALCALEDKSPEIGKEAILKLLQEVDSFIPTPVRELDKPFLLPVENVYSI--PG------RGT 297
            ..||..          |..|..|.:.:.:.||.|.|:.:.|..|.|...:.:  ||      :|.
  Fly   222 PISAQL----------KYNIDVLCEYIVNKIPVPPRDFNAPPRLIVIRSFDVNKPGCEVADLKGG 276

  Fly   298 VVTGRLERGVVKKGMECEFVGYNKVLKST---VTGVEMFHQI---------LEEAQAGDQLGALV 350
            |..|.:..||:|.|.|.| |....|.|.:   :|...:|.:|         |:.|..|..:|.  
  Fly   277 VAGGSILSGVLKVGQEIE-VRPGVVTKDSDGNITCRPIFSRIVSLFAEQNELQYAVPGGLIGV-- 338

  Fly   351 RGVK------RDDIKRGMVMCKPGSVKAL-DQLEAQVYILSKDEGGRTKPFMSFIQLQMFSRTWD 408
             |.|      |.|...|.|:...|.:..: .:||...|:|.:..|.||.......:::...:...
  Fly   339 -GTKIDPTLCRADRLVGQVLGAVGQLPDIYQELEISYYLLRRLLGVRTDGDKKGARVEKLQKNEI 402

  Fly   409 CAVQV---QIPDKEMVMPGEDTKLILRLIRPMVLEQGQRFTL--RDGN--LTLGTGVV--TSTLP 464
            ..|.:   ....:.....|:..|::  |..|:..|:|::..|  |..|  ..:|.|.:  ..|:.
  Fly   403 LLVNIGSLSTGGRISATKGDLAKIV--LTTPVCTEKGEKIALSRRVENHWRLIGWGQIFGGKTIT 465

  Fly   465 PLTESQ 470
            |:.:||
  Fly   466 PVLDSQ 471

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mEFTu1NP_001163144.1 PRK00049 73..463 CDD:234596 112/453 (25%)
EF_Tu 81..274 CDD:206671 59/228 (26%)
EFTU_II 282..368 CDD:293898 29/112 (26%)
mtEFTU_III 371..462 CDD:294005 19/101 (19%)
eIF2gammaNP_001262587.1 PTZ00327 11..465 CDD:240362 112/454 (25%)
eIF2_gamma 41..247 CDD:206675 60/230 (26%)
eIF2_gamma_II 248..361 CDD:293889 30/117 (26%)
eIF2_gamma_III 364..458 CDD:294011 19/96 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C86481320
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.