| Sequence 1: | NP_001163144.1 | Gene: | mEFTu1 / 44438 | FlyBaseID: | FBgn0024556 | Length: | 489 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001262587.1 | Gene: | eIF2gamma / 41843 | FlyBaseID: | FBgn0263740 | Length: | 475 | Species: | Drosophila melanogaster |
| Alignment Length: | 461 | Identity: | 115/461 - (24%) |
|---|---|---|---|
| Similarity: | 183/461 - (39%) | Gaps: | 105/461 - (22%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 84 NVGTIGHVDHGKTTLTAAITKVLADKQLAESKKYNEIDNAPEEKARGITINVAHVE---YQTE-- 143
Fly 144 --------------------------------TRHYGHTDCPGHADYIKNMITGTAQMDGAILVV 176
Fly 177 AATDGA-MPQTREHMLLAKQIGIDHIVVFINKVDAADEEMVDLVEMEIRELLTEMGYDGDKIPVV 240
Fly 241 KGSALCALEDKSPEIGKEAILKLLQEVDSFIPTPVRELDKPFLLPVENVYSI--PG------RGT 297
Fly 298 VVTGRLERGVVKKGMECEFVGYNKVLKST---VTGVEMFHQI---------LEEAQAGDQLGALV 350
Fly 351 RGVK------RDDIKRGMVMCKPGSVKAL-DQLEAQVYILSKDEGGRTKPFMSFIQLQMFSRTWD 408
Fly 409 CAVQV---QIPDKEMVMPGEDTKLILRLIRPMVLEQGQRFTL--RDGN--LTLGTGVV--TSTLP 464
Fly 465 PLTESQ 470 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| mEFTu1 | NP_001163144.1 | PRK00049 | 73..463 | CDD:234596 | 111/452 (25%) |
| EF_Tu | 81..274 | CDD:206671 | 59/227 (26%) | ||
| EFTU_II | 282..368 | CDD:293898 | 29/111 (26%) | ||
| mtEFTU_III | 371..462 | CDD:294005 | 19/100 (19%) | ||
| eIF2gamma | NP_001262587.1 | PTZ00327 | 11..465 | CDD:240362 | 112/453 (25%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C45464541 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.840 | |||||