DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mEFTu1 and CG2017

Sequence 1:NP_001163144.1 Gene:mEFTu1 FlyBaseID:FBgn0024556 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_649603.3 Gene:CG2017 FlyBaseID:FBgn0037391 Length:643 Species:Drosophila melanogaster

Alignment Length:495 Identity:102/496 (21%)
Similarity:190/496 (38%) Gaps:86/496 (17%)


  Fly    28 SSARMLRMAGATATSTACKDWQRNGLLAAPRTGNMQQYLREYANEKKVFERTKPHCNVGTIGHVD 92
            |...:.:||.:...||:.   .|...:|| |....:..:|:..:::...|     ..|..:|..|
  Fly   170 SLTTLKQMAHSLGASTSV---LRRKTIAA-RRAVAEVLVRKIPDDQHNIE-----VRVAVLGGAD 225

  Fly    93 HGKTTLTAAITKVLADK-----QLAESKKYNEIDNAPEE---------KARGITINVAHVEYQT- 142
            .||:||...:|:...|.     :|...:..:||.:....         .|.|..:|..:.|..| 
  Fly   226 AGKSTLLGVLTQDELDNGHGRARLNMFRHMHEIQSGRTSCISHETLGFDALGNVVNYKYNEMMTA 290

  Fly   143 ------ETRHYGHTDCPGHADYIKNMITGTAQMDG-----AILVVAATDGAMPQTREHMLLAKQI 196
                  .::.....|..||..|::   |....:.|     |:|||:|..|....|.||:.:.:.:
  Fly   291 EEISDRSSKLVTFMDLAGHRRYMR---TTVQALSGYSPHYAMLVVSAGSGCNDTTEEHLAIVRAL 352

  Fly   197 GIDHIVVFINKVDAADEEMVDLVEMEIRELLTEMGYDGDKIPVVKGSALCALEDKSPEIGKEAI- 260
            .:...|: :.|.|....   |....|:..|||.:|.  .|:|.|..:...|:...|.:|.:..: 
  Fly   353 DMPFFVL-VTKTDITSP---DATVQELCNLLTTIGC--RKVPFVVTNTDEAISAGSNQISENIVP 411

  Fly   261 -----------LKLLQEVDSFIPTPVRELDKPFL------LPVENVYSIPGRGTVVTGRLERGVV 308
                       |.|:.:....:...:...:|..|      ..|:.::.:...|.||.|.|.:||:
  Fly   412 IFCVSNVTGTGLNLVTKFLYVLSPGISNAEKDRLEQESCEFQVDEIFRVSDVGPVVGGLLVQGVL 476

  Fly   309 KKGMECEFVG------YNKVLKSTVTGVEMFHQILEEAQAGDQLGALVRGVKRDDIKRGMVMCKP 367
            .:.|..: :|      ::.|..:|:...:...:::...|:.....::.:.|  ..::.|||:.  
  Fly   477 TENMAMK-IGPLPDGSFHPVTVNTIHRNKAPCRVVRAGQSASLSFSMDQDV--PTLRSGMVLL-- 536

  Fly   368 GSV-KALDQ------LEAQVYILSKDEGGRTKPFMSFIQLQMFSRTWDCAVQVQIPDKEMVMPGE 425
            |.: .:||:      .:|:|.:|..    .|..::.|............||...|...|.:...:
  Fly   537 GDIGNSLDEPYGTFFFQAKVSVLFH----ATAIYVGFQTTVHIGSIRQTAVIRGIMGGERLGTND 597

  Fly   426 DTKLILRLI-RPMVLEQGQRFTLRDGNLTLGTGVVTSTLP 464
            ...::...: .|..:..|.|...|:|. :.|.||||...|
  Fly   598 CASVMFEFVGHPEYVRPGMRILFREGT-SKGIGVVTQVFP 636

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mEFTu1NP_001163144.1 PRK00049 73..463 CDD:234596 91/448 (20%)
EF_Tu 81..274 CDD:206671 49/231 (21%)
EFTU_II 282..368 CDD:293898 18/98 (18%)
mtEFTU_III 371..462 CDD:294005 21/98 (21%)
CG2017NP_649603.3 GTPBP1 100..635 CDD:227583 101/493 (20%)
GTPBP1_like 217..436 CDD:206728 49/228 (21%)
GTPBP_II 450..536 CDD:293895 17/89 (19%)
GTPBP_III 547..634 CDD:294007 19/92 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C87661058
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR43721
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.