DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mEFTu1 and CG33158

Sequence 1:NP_001163144.1 Gene:mEFTu1 FlyBaseID:FBgn0024556 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_788515.1 Gene:CG33158 FlyBaseID:FBgn0053158 Length:1033 Species:Drosophila melanogaster

Alignment Length:463 Identity:105/464 (23%)
Similarity:176/464 (38%) Gaps:127/464 (27%)


  Fly    84 NVGTIGHVDHGKTTLTAAI--TKVLADKQLAESKKYNEIDNAPEEKARGITINVAHVE--YQTET 144
            |:..:.|||||||||..::  :..:..:::|...:|  :||..:|:.||||:..:.:.  ||...
  Fly    21 NICILAHVDHGKTTLADSLVASNGIISQRMAGKLRY--LDNRSDEQERGITMKSSSISLYYQEAE 83

  Fly   145 RHYGH-------TDCPGHADYIKNMITGTAQMDGAILVVAATDGAMPQTREHMLLAKQIGIDHI- 201
            ...|:       .|.|||.|:...:.|.....||||:||...:|..||||..:   :||..:.: 
  Fly    84 EMAGNPDYLINLIDSPGHVDFSSEVSTAVRLCDGAIVVVDVVEGVGPQTRACL---RQIYEEQLK 145

  Fly   202 -VVFINKVDAAD-EEMVDLVE--MEIRELLTEMGYDGDKIPVVKGSALCALEDKSPEIGKEAILK 262
             |:.:||:|... |:.:|.::  ..:.::|       :::..|.||...     |..:.||.|.|
  Fly   146 PVLVLNKLDRLILEKQMDPLDAYFHLCQVL-------EQVNAVLGSIFA-----SDILAKEDITK 198

  Fly   263 ------LLQEVDSFIPTPVRELDKPFLLPVENVYSIPGRGTVV-------------------TGR 302
                  .|:|||.                 ..:|..|..|.|:                   ..|
  Fly   199 KDNYESALEEVDD-----------------SELYFSPSSGNVIFCSAYDGWAFSVRDFAAMYAKR 246

  Fly   303 LERGVVKKGMECEFVG---YNKVLKSTVTGVE------MFHQILEEAQAGDQLGAL--VRGVKRD 356
            ||  :.:|.:|....|   ||...|..:.|.:      ||.|.:.|     .:.:|  :..:::|
  Fly   247 LE--MSRKDLENVLWGDFYYNSKKKEALPGAQEKAKKPMFVQFVLE-----NIWSLYDIIAIRKD 304

  Fly   357 DIKRGMVMCKPGSVKALDQLEAQVYILSKDEGGRTKPFMSFIQLQMFSRTW--------DCAVQV 413
            ..|...:..|.|...|...|..            |.|   .:|::.....|        ...:| 
  Fly   305 KDKLPGIAEKLGLKLATRDLRL------------TDP---KLQIKAVLGQWLPIDKSVLHMVIQ- 353

  Fly   414 QIPDKEMVMPGEDTKLI------LRLIRPMVLEQGQRFTLRDGNLTLGTGVVTSTLP----PLTE 468
            .:|....:......:|:      |..:.|..||..:.||..|.|.:.....|:...|    .|.:
  Fly   354 HVPPPHKISDERAQRLLYPANVDLSSLPPETLELKESFTSCDANSSNVIAFVSKMTPVHITHLPQ 418

  Fly   469 SQRSELTE 476
            ::...||:
  Fly   419 NRPKRLTD 426

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mEFTu1NP_001163144.1 PRK00049 73..463 CDD:234596 101/445 (23%)
EF_Tu 81..274 CDD:206671 60/212 (28%)
EFTU_II 282..368 CDD:293898 22/116 (19%)
mtEFTU_III 371..462 CDD:294005 18/105 (17%)
CG33158NP_788515.1 PTZ00416 15..1016 CDD:240409 105/464 (23%)
EF2 20..249 CDD:206672 67/264 (25%)
EF2_II 485..572 CDD:293913
EF2_snRNP_III 587..658 CDD:293918
aeEF2_snRNP_like_IV 658..899 CDD:238839
eEF2_snRNP_like_C 896..974 CDD:239763
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C87369977
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.