DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mEFTu1 and waw

Sequence 1:NP_001163144.1 Gene:mEFTu1 FlyBaseID:FBgn0024556 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_001027089.1 Gene:waw FlyBaseID:FBgn0024182 Length:696 Species:Drosophila melanogaster

Alignment Length:472 Identity:113/473 (24%)
Similarity:181/473 (38%) Gaps:121/473 (26%)


  Fly    66 LREYANEKKVFERTKPHCNVGTIGHVDHGKTT-------LTAAITKVLADKQLAESKKYNEIDNA 123
            |||:|:  ...||.:   |...|.||||||:|       ||.||.:        ...::..:||.
  Fly    88 LREFAH--MPVERIR---NFSIIAHVDHGKSTLADRLLELTGAIAR--------NGGQHQVLDNL 139

  Fly   124 PEEKARGITINVAHVEYQTET---RHYGH------TDCPGHADYIKNMITGTAQMDGAILVVAAT 179
            ..|:.||||     |:.||.:   ||.|.      .|.|||.|:...:....|..||.:|:|.|.
  Fly   140 QVERERGIT-----VKAQTASIFHRHKGQLYLLNLIDTPGHVDFSNEVSRSLAACDGVVLLVDAC 199

  Fly   180 DGAMPQTREHMLLAKQIGIDHIVVFINKVDA--ADEEMVDLVEMEIRELLTEMGYDGDKIPVVKG 242
            .|...||..:..||||..: .:|..:||:|.  |:.:.|      .::|....|.|.|::..|  
  Fly   200 HGVQAQTVANYHLAKQRQL-AVVPVLNKIDIKHANPDQV------CQDLKLLFGIDPDEVLRV-- 255

  Fly   243 SALCALEDKSPEIGKEAILKLLQEVDSFIPTPVRELDKPFLLPVENVYSIPGRGT-----VVTGR 302
                     |.::| ..:.::|:.|...:|.|..:.|..|...:.:.:....||.     |:.|:
  Fly   256 ---------SAKLG-TGVSEVLERVIETVPPPQVQRDSDFRALIFDSWFDKYRGALNLIYVLNGK 310

  Fly   303 LERG-----------------VVKKGMECE----------FVGYN-KVLKSTVTG--VEMFHQIL 337
            ||:.                 .|.:..||.          .:..| :..|.::.|  :.:.:|.:
  Fly   311 LEQNQDIQSLATKKVYSVKSISVLRPAECPVPDVSAGQVGLIACNMRNSKESIVGDTIHLKNQAV 375

  Fly   338 EEAQAGD---QLGALVRGVKRDDIKRGMVMCKPGSVKALDQLEAQVYILSK---DEGGRTKPFMS 396
              |.||.   |...:..||...|..:.:.:........|:.....|.|.|.   .:|.|. .|:.
  Fly   376 --AAAGSYRPQQPLVFAGVFPADQSKHVALRSAIDKMVLNDSAVTVKIDSSPALGQGWRL-GFLG 437

  Fly   397 FIQLQMFSRTWDCAVQVQIPDKEMVMPGEDTKLILRLIRPMVLEQGQRFTLRDGN---------- 451
            .:.:::|     |....|....|.::........|.|..|.:::|..|.|:...|          
  Fly   438 LLHMEVF-----CQRLEQEHGAEPIITAPSVTYRLVLSNPKMIKQQGRDTMDISNAALFPEPHSI 497

  Fly   452 ------LTLGTGVVTST 462
                  |.||| ::|.|
  Fly   498 KEYYEPLVLGT-IITPT 513

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mEFTu1NP_001163144.1 PRK00049 73..463 CDD:234596 109/466 (23%)
EF_Tu 81..274 CDD:206671 60/211 (28%)
EFTU_II 282..368 CDD:293898 21/124 (17%)
mtEFTU_III 371..462 CDD:294005 23/110 (21%)
wawNP_001027089.1 PRK05433 94..695 CDD:235462 109/465 (23%)
LepA 100..277 CDD:206677 60/212 (28%)
EF4_II 285..370 CDD:293900 13/85 (15%)
EF4_III 386..461 CDD:293917 14/81 (17%)
lepA_C 502..581 CDD:239680 6/14 (43%)
LepA_C 589..695 CDD:283959
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C87712346
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.