DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mEFTu1 and eEFSec

Sequence 1:NP_001163144.1 Gene:mEFTu1 FlyBaseID:FBgn0024556 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_611584.1 Gene:eEFSec FlyBaseID:FBgn0034627 Length:511 Species:Drosophila melanogaster

Alignment Length:311 Identity:85/312 (27%)
Similarity:150/312 (48%) Gaps:53/312 (17%)


  Fly    84 NVGTIGHVDHGKTTLTAAITKVLADKQLAESKKYNEIDNAPEEKARGITINV----------AHV 138
            |:|.:||||.|||||..|::.:.:..         ..|..|:...||||:::          ||:
  Fly     6 NIGLLGHVDSGKTTLAKALSSISSTA---------AFDKNPQSVERGITLDLGFSGLLVDAPAHL 61

  Fly   139 EYQTETRHYGHTDCPGHADYIKNMITGTAQMDGAILVVAATDGAMPQTREHMLLAKQIGIDHIVV 203
            . |.|...:...||||||..|:.:|.|...:|..:|||.|..|...||.|.:::.:.:. ..::|
  Fly    62 P-QGEQLQFTFVDCPGHASLIRTIIGGAQIIDLMLLVVDAQKGKQTQTAECLIIGELLQ-KKLIV 124

  Fly   204 FINKVDAADEEM----VDLVEMEIRELLTEMGYDGDKIPV-----VKGSALCALEDKSPEIGKEA 259
            .|||:|...|..    ::.:.:.:.:.|....: |.::|:     ::|:.:..|.    |:.:||
  Fly   125 VINKIDVYPENQRASKLEKLRLRLAKTLEATTF-GGQVPICAVSALQGTHIAELR----EVLREA 184

  Fly   260 ILKLLQEVDSFIPTPVRELDKPFLLPVENVYSIPGRGTVVTGRLERGVVKKG--MECEFVGYNKV 322
            ..:           |.|.|..|..:.|::.:.|.|:|||.||.|.:|.|:..  :|...:|..:.
  Fly   185 YFQ-----------PQRNLADPLFMYVDHCFGIKGQGTVCTGTLLQGKVQVNNVIELPALGEQRK 238

  Fly   323 LKSTVTGVEMFHQILEEAQAGDQLGALVRGVKRDDIKRGMVMCKPGSVKAL 373
            :||    ::||.:.:..|..||::|..|.......::|| ::.:||.:|.:
  Fly   239 VKS----IQMFRKNVTSASMGDRIGLCVTQFNAKLLERG-IITQPGYLKPI 284

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mEFTu1NP_001163144.1 PRK00049 73..463 CDD:234596 85/312 (27%)
EF_Tu 81..274 CDD:206671 54/209 (26%)
EFTU_II 282..368 CDD:293898 25/88 (28%)
mtEFTU_III 371..462 CDD:294005 1/4 (25%)
eEFSecNP_611584.1 SelB_euk 5..192 CDD:206676 56/213 (26%)
SelB 6..467 CDD:225815 85/312 (27%)
SelB_II 196..278 CDD:293897 24/87 (28%)
eSelB_III 283..396 CDD:294009 0/3 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C87700290
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR43721
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.