DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mEFTu1 and Dgp-1

Sequence 1:NP_001163144.1 Gene:mEFTu1 FlyBaseID:FBgn0024556 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_611302.1 Gene:Dgp-1 FlyBaseID:FBgn0027836 Length:669 Species:Drosophila melanogaster

Alignment Length:520 Identity:118/521 (23%)
Similarity:197/521 (38%) Gaps:131/521 (25%)


  Fly    28 SSARMLRMAGATATSTACKDWQRNGLLAAPRTGNMQQYL-REYANEKKVFERTKPHCNVGTIGHV 91
            :|...|.:..|...:...|..:|..     ..|...|:| |::.:.....|     ..|..:|:|
  Fly    98 ASVATLHLLAANIDADVVKLRERRA-----EKGQSAQFLIRKHIDTTDFME-----IRVAVVGNV 152

  Fly    92 DHGKTTLTAAITKVLADKQLAESKKYNEIDNA-----------PEEKARGITINVAH-------V 138
            |.||:||...:|             :.|:||.           ..|...|.|.:|.:       |
  Fly   153 DAGKSTLLGVLT-------------HGELDNGRGHARQRLFRHKHEIESGRTSSVGNDILGFDGV 204

  Fly   139 EYQTETRHYGHTD----C------------PGHADYIKNMI---TGTAQMDGAILVVAATDGAMP 184
            ........:||.|    |            .||..|:|..:   ||.|. |..:|::.|..|.:.
  Fly   205 GNVVNKPDHGHLDWVKICENSAKVITFIDLAGHERYLKTTVFGMTGHAP-DFGMLMIGANAGIIG 268

  Fly   185 QTREHMLLAKQIGIDHIVVFINKVDAADEEMVDLVEMEIRELLTEM--GYDGDKIPVVKGS---- 243
            .|:||:.||..:.:. :.|.:.|:|.....::    .|..:||.:|  .....|:|||..|    
  Fly   269 MTKEHLGLALALAVP-VFVVVTKIDMCPANVL----QENMKLLFKMLKSQGCRKVPVVVRSHDDV 328

  Fly   244 ----------ALCALEDKSPEIGKEAILKLLQEVDSFIPT--PVRELDKPFLLPVENVYSIPGRG 296
                      .||.:...|...|..  |:||:...:.:.|  |..| ..|....:::||::||.|
  Fly   329 VLSATNFVSERLCPIFQVSNVTGDN--LELLKMFLNLLSTRMPGSE-SLPAEFQIDDVYAVPGVG 390

  Fly   297 TVVTGRLERGVVKKGMECEFVGYNKV---LKSTVTGVEMFHQILEEAQAGDQLGALVRGVKRDDI 358
            |||:|...:|.::.. :|..:|.:.|   :..|:..:......:...:.|......::.:||..:
  Fly   391 TVVSGTCLQGTIRLN-DCLMLGPDAVGSFVPITIKSIHRKRMNVARVRCGQTASFALKKIKRAYL 454

  Fly   359 KRGMVM----CKPGSVKALDQLEAQVYIL-----------SKDEGGRTKPFMSFIQLQMFSRTWD 408
            ::||||    .||   :|..:.|.::.:|           :....|..:...|.|.:   ||  |
  Fly   455 RKGMVMVSQDLKP---QACWEFEGEILVLHHPTTISARYQAMVHCGSIRQTASIIHM---SR--D 511

  Fly   409 CAVQVQIPDKEMVMPGEDTKLILRLIR-PMVLEQGQRFTLRDGNLTLGTGVVTSTLPPLTESQRS 472
            |           :..|:...:..|.|: |..:..|||...|:|.    |..|.:.|.||..:..|
  Fly   512 C-----------LRTGDKAHVKFRFIKQPEYIRAGQRLVFREGR----TKAVGNILRPLPNAAAS 561

  Fly   473  472
              Fly   562  561

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mEFTu1NP_001163144.1 PRK00049 73..463 CDD:234596 105/464 (23%)
EF_Tu 81..274 CDD:206671 57/248 (23%)
EFTU_II 282..368 CDD:293898 23/93 (25%)
mtEFTU_III 371..462 CDD:294005 21/103 (20%)
Dgp-1NP_611302.1 GTPBP1 38..555 CDD:227583 116/513 (23%)
GTPBP1_like 145..367 CDD:206728 57/243 (23%)
GTPBP_II 376..462 CDD:293895 21/87 (24%)
GTPBP_III 468..553 CDD:294007 22/105 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C87740235
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR43721
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.