DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mEFTu1 and eEF1alpha1

Sequence 1:NP_001163144.1 Gene:mEFTu1 FlyBaseID:FBgn0024556 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_001286321.1 Gene:eEF1alpha1 FlyBaseID:FBgn0284245 Length:463 Species:Drosophila melanogaster

Alignment Length:495 Identity:145/496 (29%)
Similarity:222/496 (45%) Gaps:117/496 (24%)


  Fly    78 RTKPHCNVGTIGHVDHGKTTLT-------AAITKVLADKQLAESKKYNE--------IDNAPEEK 127
            :.|.|.|:..|||||.||:|.|       ..|.|...:|...|:::..:        :|....|:
  Fly     3 KEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 67

  Fly   128 ARGITINVAHVEYQTETRHYGHTDCPGHADYIKNMITGTAQMDGAILVVAATDGAMP-------Q 185
            .|||||::|..:::|...:....|.|||.|:||||||||:|.|.|:|:|||..|...       |
  Fly    68 ERGITIDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQ 132

  Fly   186 TREHMLLAKQIGIDHIVVFINKVDAAD----EEMVDLVEMEIRELLTEMGYD------------- 233
            ||||.|||..:|:..::|.:||:|:::    |...:.::.|:...:.::||:             
  Fly   133 TREHALLAFTLGVKQLIVGVNKMDSSEPPYSEARYEEIKKEVSSYIKKIGYNPAAVAFVPISGWH 197

  Fly   234 GD-------KIPVVKGSALCALEDKSPEIGKEAILKLLQEVDSFIPTPVRELDKPFLLPVENVYS 291
            ||       .:|..||..:...|..:.  ||    .|:..:|:.:| |.|..||...||:::||.
  Fly   198 GDNMLEPSTNMPWFKGWKVERKEGNAD--GK----TLIDALDAILP-PARPTDKALRLPLQDVYK 255

  Fly   292 IPGRGTVVTGRLERGVVKKGMECEFVGYNKVLKSTVTGVEMFHQILEEAQAGDQLGALVRGVKRD 356
            |.|.|||..||:|.||:|.|....|...|  :.:.|..|||.|:.|:||..||.:|..|:.|...
  Fly   256 IGGIGTVPVGRVETGVLKPGTVVVFAPAN--ITTEVKSVEMHHEALQEAVPGDNVGFNVKNVSVK 318

  Fly   357 DIKRGMVM--CKPGSVKALDQLEAQVYILS---KDEGGRTKPFM---------SFIQLQ------ 401
            :::||.|.  .|....|......|||.:|:   :...|.| |.:         .|.:::      
  Fly   319 ELRRGYVAGDSKANPPKGAADFTAQVIVLNHPGQIANGYT-PVLDCHTAHIACKFAEIKEKVDRR 382

  Fly   402 ---------MFSRTWDCAVQVQIPDKEMVMPGEDTKLILRLIRPMVLEQGQ------RFTLRDGN 451
                     .|.::.|.|:...:|.|                 |:.:|..|      ||.:||..
  Fly   383 SGKTTEENPKFIKSGDAAIVNLVPSK-----------------PLCVEAFQEFPPLGRFAVRDMR 430

  Fly   452 LTLGTGVVTSTLPPLTESQRSELTEGK--KAREKKVAAKK 489
            .|:..||:.:.       ...:.:.||  ||.||....||
  Fly   431 QTVAVGVIKAV-------NFKDASGGKVTKAAEKATKGKK 463

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mEFTu1NP_001163144.1 PRK00049 73..463 CDD:234596 137/466 (29%)
EF_Tu 81..274 CDD:206671 73/239 (31%)
EFTU_II 282..368 CDD:293898 35/88 (40%)
mtEFTU_III 371..462 CDD:294005 24/124 (19%)
eEF1alpha1NP_001286321.1 PTZ00141 1..457 CDD:185474 142/488 (29%)
EF1_alpha 9..238 CDD:206670 72/236 (31%)
EF1_alpha_II 242..332 CDD:293894 37/92 (40%)
EF1_alpha_III 335..438 CDD:294004 24/121 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C87706107
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.