DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mEFTu1 and mEFTu2

Sequence 1:NP_001163144.1 Gene:mEFTu1 FlyBaseID:FBgn0024556 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_610288.1 Gene:mEFTu2 FlyBaseID:FBgn0033184 Length:456 Species:Drosophila melanogaster

Alignment Length:421 Identity:217/422 (51%)
Similarity:301/422 (71%) Gaps:14/422 (3%)


  Fly    48 WQRNGLLAAPRTGNMQQYLREYANEKKVFERTKPHCNVGTIGHVDHGKTTLTAAITKVLADKQLA 112
            |....|||.....|....|||.           |||||||||||||||||||||||::.:.|.||
  Fly    34 WTGTRLLATSADKNPAPGLREL-----------PHCNVGTIGHVDHGKTTLTAAITRIQSQKGLA 87

  Fly   113 ESKKYNEIDNAPEEKARGITINVAHVEYQTETRHYGHTDCPGHADYIKNMITGTAQMDGAILVVA 177
            |...|::||.||||||||||||..|:.|.|..|.|.|||||||||||||||:|.:||||||||||
  Fly    88 EYLSYDQIDRAPEEKARGITINACHIGYSTTERTYAHTDCPGHADYIKNMISGASQMDGAILVVA 152

  Fly   178 ATDGAMPQTREHMLLAKQIGIDHIVVFINKVDAADEEMVDLVEMEIRELLTEMGYDGDKIPVVKG 242
            ||||.|||||||:|||||:||..|:|||||.|..|:|:::|||:|:||:|::.|:||...||:.|
  Fly   153 ATDGQMPQTREHLLLAKQVGIQRIIVFINKADLVDQEVLELVEIEMREMLSDFGFDGVNSPVICG 217

  Fly   243 SALCALEDKSPEIGKEAILKLLQEVDSFIPTPVRELDKPFLLPVENVYSIPGRGTVVTGRLERGV 307
            |||.||.:...|.|..:|.|||::.||:||||.|::..||:||::|.:::|||||||.|.::||.
  Fly   218 SALLALREDKSEFGVPSIEKLLEQCDSYIPTPQRDISSPFILPIDNAFTVPGRGTVVVGTIKRGT 282

  Fly   308 VKKGMECEFVGYNKVLKSTVTGVEMFHQILEEAQAGDQLGALVRGVKRDDIKRGMVMCKPGSVKA 372
            :.:..:.:.:|:|:.||::::.:::|.:.:.:||||:.:|||:||:|...::|||::|..||...
  Fly   283 IPRNADADLLGFNQNLKTSISDIQIFRKSVPQAQAGENVGALLRGIKISAVERGMLLCATGSEDI 347

  Fly   373 LDQLEAQVYILSKDEGGRTKPFMS-FIQLQMFSRTWDCAVQVQI-PDKEMVMPGEDTKLILRLIR 435
            .:..|..:|:||:.||||.||.:| :|| |:||:||:...::.| |.:.|:||||..::.:.|:|
  Fly   348 SNHFEGSMYLLSRAEGGRVKPMLSKYIQ-QLFSQTWNVPARIDIVPSEAMLMPGEHGQVRVTLLR 411

  Fly   436 PMVLEQGQRFTLRDGNLTLGTGVVTSTLPPL 466
            .||:..||.||:|:...|:.||:||..||.|
  Fly   412 KMVMTPGQAFTIRENGATVATGMVTQRLPSL 442

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mEFTu1NP_001163144.1 PRK00049 73..463 CDD:234596 206/392 (53%)
EF_Tu 81..274 CDD:206671 129/193 (67%)
EFTU_II 282..368 CDD:293898 33/86 (38%)
mtEFTU_III 371..462 CDD:294005 39/93 (42%)
mEFTu2NP_610288.1 PRK00049 53..437 CDD:234596 208/396 (53%)
EF_Tu 56..249 CDD:206671 129/193 (67%)
EFTU_II 257..343 CDD:293898 33/86 (38%)
mtEFTU_III 347..437 CDD:294005 39/91 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C87707819
eggNOG 1 0.900 E1_COG0050
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S366
OrthoDB 1 1.010 D298219at33208
OrthoFinder 1 1.000 FOG0003422
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR43721
RoundUp 00.000 Not matched by this tool.
65.890

Return to query results.
Submit another query.