DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mEFTu1 and eEF2

Sequence 1:NP_001163144.1 Gene:mEFTu1 FlyBaseID:FBgn0024556 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_525105.2 Gene:eEF2 FlyBaseID:FBgn0000559 Length:844 Species:Drosophila melanogaster

Alignment Length:560 Identity:108/561 (19%)
Similarity:179/561 (32%) Gaps:229/561 (41%)


  Fly    84 NVGTIGHVDHGKTTLTAAITK---VLADKQLAESKKYNEIDNAPEEKARGITIN----------- 134
            |:..|.||||||:|||.::..   ::|..:..|::   ..|...:|:.|.|||.           
  Fly    21 NMSVIAHVDHGKSTLTDSLVSKAGIIAGAKAGETR---FTDTRKDEQERCITIKSTAISMYFEVE 82

  Fly   135 ------VAHVEYQTETRHYGH----TDCPGHADYIKNMITGTAQMDGAILVVAATDGAMPQTRE- 188
                  :.|.: |.|....|.    .|.|||.|:...:.......|||::||....|...||.. 
  Fly    83 EKDLVFITHPD-QREKECKGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETV 146

  Fly   189 -HMLLAKQIGIDHIVVFINKVDAADEEM-VDLVEM--------------------------EIR- 224
             ...:|::|   ..::|:||:|.|..|: :|..|:                          |:| 
  Fly   147 LRQAIAERI---KPILFMNKMDRALLELQLDAEELYQTFQRIVENVNVIIATYNDDGGPMGEVRV 208

  Fly   225 --------------------ELLTEMGYDGDKIPVVK--------------------------GS 243
                                :..:||..:..||.|||                          ..
  Fly   209 DPSKGSVGFGSGLHGWAFTLKQFSEMYSEKFKIDVVKLMNRLWGENFFNAKTKKWQKQKEADNKR 273

  Fly   244 ALC-------------ALEDKSPEIGK------------------EAILK------------LLQ 265
            :.|             .:..|..|||.                  :|:||            |||
  Fly   274 SFCMYILDPIYKVFDAIMNYKKEEIGTLLEKIGVTLKHEDKDKDGKALLKTVMRTWLPAGEALLQ 338

  Fly   266 EVDSFIPTPV------REL-------------------DKPFLLPVENVYSIPGRGTVVT-GRLE 304
            .:...:|:||      .|:                   |.|.::.:..:.....:|.... ||:.
  Fly   339 MIAIHLPSPVVAQKYRMEMLYEGPHDDEAAIAVKSCDPDGPLMMYISKMVPTSDKGRFYAFGRVF 403

  Fly   305 RGVVKKGMECEFVG-----------YNKVLKSTVTGVEMFHQILEEAQAGDQLGALVRGVKRDDI 358
            .|.|..|.:|..:|           |.|.::.|:..:..:.:.:|:..:|:..|.:  ||.:..:
  Fly   404 AGKVATGQKCRIMGPNYTPGKKEDLYEKAIQRTILMMGRYVEAIEDVPSGNICGLV--GVDQFLV 466

  Fly   359 KRGMVMCKPGSVKALDQLEAQVYILSKDEGGRTKPFMSFIQLQMFSRTWDCAVQVQIPDKEMVMP 423
            |.|.:.    :.|....::...:.:|.                        .|:|.:..|.   |
  Fly   467 KTGTIT----TFKDAHNMKVMKFSVSP------------------------VVRVAVEPKN---P 500

  Fly   424 GEDTKLILRLIR-----PMVL----EQGQRFTLRDGNLTL 454
            .:..||:..|.|     |||.    |.|:......|.|.|
  Fly   501 ADLPKLVEGLKRLAKSDPMVQCIIEESGEHIIAGAGELHL 540

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mEFTu1NP_001163144.1 PRK00049 73..463 CDD:234596 108/561 (19%)
EF_Tu 81..274 CDD:206671 67/333 (20%)
EFTU_II 282..368 CDD:293898 18/98 (18%)
mtEFTU_III 371..462 CDD:294005 18/94 (19%)
eEF2NP_525105.2 PTZ00416 1..844 CDD:240409 108/561 (19%)
EF2 20..236 CDD:206672 50/222 (23%)
EF2_snRNP_like_II 380..474 CDD:293901 18/100 (18%)
EF2_snRNP_III 489..560 CDD:293918 16/80 (20%)
aeEF2_snRNP_like_IV 560..732 CDD:238839
eEF2_snRNP_like_C 728..807 CDD:239763
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C87635257
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.