DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mEFTu1 and eRF3

Sequence 1:NP_001163144.1 Gene:mEFTu1 FlyBaseID:FBgn0024556 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_001260415.1 Gene:eRF3 FlyBaseID:FBgn0020443 Length:619 Species:Drosophila melanogaster

Alignment Length:452 Identity:130/453 (29%)
Similarity:209/453 (46%) Gaps:79/453 (17%)


  Fly    71 NEKKVFE----RTK-PHCNVGTIGHVDHGKTTLTAAITKV--LADKQLAESKKYNE--------- 119
            ::|||.:    |:| .|.||..|||||.||:|:...|..:  :.||:..|  ||..         
  Fly   179 SKKKVVKVEENRSKREHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLE--KYEREAREKSRES 241

  Fly   120 ------IDNAPEEKARGITINVAHVEYQTETRHYGHTDCPGHADYIKNMITGTAQMDGAILVVAA 178
                  :|...||:.:|.|:.|....::|:.:|:...|.|||..::.|||.|.||.|.|:||::|
  Fly   242 WYLSWALDTNQEERDKGKTVEVGRAFFETDRKHFTILDAPGHKSFVPNMIGGAAQADLAVLVISA 306

  Fly   179 TDGAMP-------QTREHMLLAKQIGIDHIVVFINKVDAA----DEEMVDLVEMEIRELLTEMGY 232
            ..|...       |||||.:|||..|:.|:||.:||:|..    |:...:..:.:|...|.::|:
  Fly   307 RKGEFETGFDRGGQTREHAMLAKTAGVKHLVVLVNKMDDPTVNWDQTRYNECKDKILPYLKKLGF 371

  Fly   233 DGDK----IPVVKGSALCALEDKSPE-----IGKEAILKLLQEVDSFIPTPVRELDKPFLLPVEN 288
            :..|    :| ..|.:...|:|:.||     ....|.:..:.|    :|:..|:.|.||::|:.:
  Fly   372 NPAKDLTFMP-CSGLSGYGLKDQIPETLCPWYRGPAFIPFIDE----LPSLNRKSDGPFIMPIVD 431

  Fly   289 VYSIPGRGTVVTGRLERGVVKKGMECEFVGYNKVLKSTVTGV---EMFHQILEEAQA--GDQLGA 348
            .|.  ..||||.|::|.|..:||.       |.::....|.|   ::|....|....  |:.:..
  Fly   432 KYK--DMGTVVMGKVESGTARKGQ-------NLLVMPNRTQVAVDQLFSDDFEVTSVGPGENVKI 487

  Fly   349 LVRGVKRDDIKRGMVMCKPGS-VKALDQLEAQVYILSKDE----GGRTKPFMSFIQLQMFSRTWD 408
            .::|::.:|:..|.|:|...: :|.....:|||.||....    |......:.....::..:...
  Fly   488 KLKGIEEEDVSPGFVLCDAANPIKTGKIFDAQVVILEHKSIICAGYSAVMHIHCAAEEVTVKALI 552

  Fly   409 CAVQVQIPDKEMVMP---GEDTKLILRL-IRPMV-LEQGQ------RFTLRDGNLTLGTGVV 459
            |.|..:..||....|   .:|...|:|: ...|: |||.:      ||||||.|.|:..|.|
  Fly   553 CLVDKKSGDKSKTRPRFVKQDQVAIMRIECSGMICLEQFKLFPQMGRFTLRDENKTIAIGKV 614

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mEFTu1NP_001163144.1 PRK00049 73..463 CDD:234596 130/451 (29%)
EF_Tu 81..274 CDD:206671 70/230 (30%)
EFTU_II 282..368 CDD:293898 23/91 (25%)
mtEFTU_III 371..462 CDD:294005 29/105 (28%)
eRF3NP_001260415.1 PAM2 12..28 CDD:284542
TEF1 191..619 CDD:227581 126/441 (29%)
EF1_alpha 197..416 CDD:206670 69/226 (31%)
eRF3_II 424..505 CDD:293906 24/90 (27%)
eRF3_C_III 511..617 CDD:294003 29/105 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C87590426
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.