DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mEFTu1 and mEFG1

Sequence 1:NP_001163144.1 Gene:mEFTu1 FlyBaseID:FBgn0024556 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_609105.1 Gene:mEFG1 FlyBaseID:FBgn0263133 Length:745 Species:Drosophila melanogaster

Alignment Length:612 Identity:133/613 (22%)
Similarity:197/613 (32%) Gaps:210/613 (34%)


  Fly    59 TGNMQQYLRE--------YA-----NEKKVFERTKPHCNVGTIGHVDHGKTTLTAAITKVLADKQ 110
            |||....||.        |:     :|.|..||.:   |:|...|:|.||||||..|  :....:
  Fly     9 TGNNTLRLRALKSLGKAGYSSHAKFSEHKPIERIR---NIGISAHIDSGKTTLTERI--LFYTGR 68

  Fly   111 LAESKKYNEIDNAPE-------EKARGITINVAHVEYQTETRHYGHTDCPGHADYIKNMITGTAQ 168
            :||..:....||...       |:.|||||..|......:..:....|.|||.|:...:......
  Fly    69 IAEMHEVRGKDNVGATMDSMELERQRGITIQSAATYTLWKDTNINIIDTPGHVDFTVEVERALRV 133

  Fly   169 MDGAILVVAATDGAMPQTREHMLLAKQIGIDHIVVFINKVDAADEE------------------- 214
            :|||:||:.|..|...||.......|:..:. .:.||||:|.....                   
  Fly   134 LDGAVLVLCAVGGVQSQTLTVNRQMKRYNVP-CLAFINKLDRLGSNPYRVLSQMRSKMNHNAAFI 197

  Fly   215 ------------MVDLVE-----------MEIR-------------------------------E 225
                        :||||.           |:||                               |
  Fly   198 QLPIGVESNCKGIVDLVREKAIYFEGEHGMDIRLDEIPQDMRVESLERRQELIEHLSNADETLGE 262

  Fly   226 L-LTEMGYDGDKI--------------PVVKGSA---------LCALEDKSPEIGKEAILKLL-- 264
            | |.|..:..|.|              ||:.|:|         |.|:.|..|..|:...|..:  
  Fly   263 LFLEEKPFTEDDIKAALRRTCINRTFTPVLVGTALKNKGVQPLLDAVLDYLPNPGEVENLGFIEK 327

  Fly   265 --QEVDSFIPTPVRELDKPFLLPVENVYSI-PGR-GTVVTGRLERGVVKKGMECEFVGYNKVLKS 325
              |:.:..:..|.|:...||   |...:.: .|| |.:...|..:||::||........||  |.
  Fly   328 EGQDPEKVVLNPARDGKDPF---VGLAFKLEAGRFGQLTYLRCYQGVLRKGDNIFNARTNK--KV 387

  Fly   326 TVTGVEMFH----QILEEAQAGDQLGALVRGVKRDDIKRG-----------------------MV 363
            .:..:...|    :.:.|..||| :.||. ||   |...|                       .:
  Fly   388 RIARLVRLHSNQMEDVNEVYAGD-IFALF-GV---DCASGDTFTTNPKNNLSMESIFVPEPVVSM 447

  Fly   364 MCKPGSVKALDQLEAQVYILSKDEGGRTKPFMSF--------------------IQLQMFSRTWD 408
            ..||.:.|..|.....:...:|::     |...|                    |..|...|.:.
  Fly   448 AIKPNNTKDRDNFSKAIARFTKED-----PTFHFFFDNDVKETLVSGMGELHLEIYAQRMEREYG 507

  Fly   409 CAVQVQIPD----KEMVMPGEDTKL-------------ILRLIRPMVLEQGQRFTLRDGNLTLGT 456
            |.|.:..|.    :.:|.|.|...|             |:.::.|  |...|...|...:.|:||
  Fly   508 CPVTLGKPKVAFRETLVGPCEFDYLHKKQSGGSGQYARIIGVMEP--LPPNQNTLLEFVDETVGT 570

  Fly   457 GVVTSTLPPLTESQRSELTEGKKAREK 483
            .|....:|.:.:..|....:|..:..|
  Fly   571 NVPKQFVPGVEKGYREMAEKGMLSGHK 597

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mEFTu1NP_001163144.1 PRK00049 73..463 CDD:234596 122/564 (22%)
EF_Tu 81..274 CDD:206671 66/301 (22%)
EFTU_II 282..368 CDD:293898 26/115 (23%)
mtEFTU_III 371..462 CDD:294005 24/128 (19%)
mEFG1NP_609105.1 EF-G 44..316 CDD:206673 63/275 (23%)
PRK12740 48..727 CDD:237186 121/571 (21%)
mtEFG1_II_like 347..427 CDD:293908 24/90 (27%)
EFG_III 441..516 CDD:293919 13/80 (16%)
EFG_mtEFG1_IV 519..636 CDD:238715 17/82 (21%)
mtEFG1_C 641..718 CDD:239764
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C87645658
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.