DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mEFTu1 and tuf1

Sequence 1:NP_001163144.1 Gene:mEFTu1 FlyBaseID:FBgn0024556 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_595746.1 Gene:tuf1 PomBaseID:SPBC9B6.04c Length:439 Species:Schizosaccharomyces pombe

Alignment Length:439 Identity:247/440 (56%)
Similarity:320/440 (73%) Gaps:11/440 (3%)


  Fly    35 MAGATATSTACKDWQRNGL------LAAPRTGNMQQYLREYANEKKVFERTKPHCNVGTIGHVDH 93
            |..|.|||...:.:::|.|      .|:..........|.||:| |||.|.|||.|:||||||||
pombe     1 MNSAKATSLLFQGFRKNCLRLNRISFASGLINRFTVPARTYADE-KVFVRKKPHVNIGTIGHVDH 64

  Fly    94 GKTTLTAAITKVLADKQLAESKKYNEIDNAPEEKARGITINVAHVEYQTETRHYGHTDCPGHADY 158
            |||||||||||.|:|...|....|::||.|||||||||||:.|||||:|..|||.|.||||||||
pombe    65 GKTTLTAAITKCLSDLGQASFMDYSQIDKAPEEKARGITISSAHVEYETANRHYAHVDCPGHADY 129

  Fly   159 IKNMITGTAQMDGAILVVAATDGAMPQTREHMLLAKQIGIDHIVVFINKVDAADEEMVDLVEMEI 223
            |||||||.|.|||||:||:||||.|||||||:|||:|:|:..|||:|||||..:.:|::|||||:
pombe   130 IKNMITGAATMDGAIIVVSATDGQMPQTREHLLLARQVGVKQIVVYINKVDMVEPDMIELVEMEM 194

  Fly   224 RELLTEMGYDGDKIPVVKGSALCALEDKSPEIGKEAILKLLQEVDSFIPTPVRELDKPFLLPVEN 288
            ||||:|.|:|||..|:|.||||||||.:.||||..:|.||::.|||:|..|.|:.|.|||:.:|:
pombe   195 RELLSEYGFDGDNTPIVSGSALCALEGREPEIGLNSITKLMEAVDSYITLPERKTDVPFLMAIED 259

  Fly   289 VYSIPGRGTVVTGRLERGVVKKGMECEFVGYNKVLKSTVTGVEMFHQILEEAQAGDQLGALVRGV 353
            |:||.|||||||||:|||.:|||.|.|.|||...||:||||:|||.:.|:.|.|||..|.|:|.:
pombe   260 VFSISGRGTVVTGRVERGTLKKGAEIEIVGYGSHLKTTVTGIEMFKKQLDAAVAGDNCGLLLRSI 324

  Fly   354 KRDDIKRGMVMCKPGSVKALDQLEAQVYILSKDEGGRTKPFMSFIQLQMFSRTWDCAVQVQIPD- 417
            ||:.:||||::.:||:|....:.:|..|||:|:||||...|:...:.|::|||.|..|::..|| 
pombe   325 KREQLKRGMIVAQPGTVAPHQKFKASFYILTKEEGGRRTGFVDKYRPQLYSRTSDVTVELTHPDP 389

  Fly   418 ---KEMVMPGEDTKLILRLIRPMVLEQGQRFTLRDGNLTLGTGVVTSTL 463
               .:|||||::.::|..||.|:|:|:|||||:|:|..|:||.:||..|
pombe   390 NDSDKMVMPGDNVEMICTLIHPIVIEKGQRFTVREGGSTVGTALVTELL 438

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mEFTu1NP_001163144.1 PRK00049 73..463 CDD:234596 234/394 (59%)
EF_Tu 81..274 CDD:206671 132/193 (68%)
EFTU_II 282..368 CDD:293898 50/86 (58%)
mtEFTU_III 371..462 CDD:294005 41/95 (43%)
tuf1NP_595746.1 PRK00049 42..439 CDD:234596 237/399 (59%)
EF_Tu 52..245 CDD:206671 132/193 (68%)
EFTU_II 253..339 CDD:293898 50/86 (58%)
EFTU_III 343..434 CDD:294006 39/91 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H2490
Inparanoid 1 1.050 484 1.000 Inparanoid score I259
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003422
OrthoInspector 1 1.000 T1124254
orthoMCL 1 0.900 OOG5_126954
Panther 1 1.100 LDO PTHR43721
Phylome 1 0.910 0.662 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R370
TreeFam 1 0.960
109.960

Return to query results.
Submit another query.