DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mEFTu1 and Tufm

Sequence 1:NP_001163144.1 Gene:mEFTu1 FlyBaseID:FBgn0024556 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_766333.1 Gene:Tufm MGIID:1923686 Length:452 Species:Mus musculus

Alignment Length:461 Identity:287/462 (62%)
Similarity:354/462 (77%) Gaps:28/462 (6%)


  Fly    27 MSSARMLRMAGATATSTACKDWQRNGLLAAPRTGNMQQYLREY-------------ANEKKVFER 78
            |::|.:||     ||.      :.:||.|:| |..:|..||..             ...||.:.|
Mouse     1 MAAATLLR-----ATP------RFSGLCASP-TPFLQGRLRPLKAPASPFLCRGLAVEAKKTYVR 53

  Fly    79 TKPHCNVGTIGHVDHGKTTLTAAITKVLADKQLAESKKYNEIDNAPEEKARGITINVAHVEYQTE 143
            .|||.|||||||||||||||||||||:||:...|:.|||.||||||||:|||||||.|||||.|.
Mouse    54 DKPHVNVGTIGHVDHGKTTLTAAITKILAEGGGAKFKKYEEIDNAPEERARGITINAAHVEYSTA 118

  Fly   144 TRHYGHTDCPGHADYIKNMITGTAQMDGAILVVAATDGAMPQTREHMLLAKQIGIDHIVVFINKV 208
            .|||.||||||||||:||||||||.:||.||||||.||.|||||||:|||||||::|:||::||.
Mouse   119 ARHYAHTDCPGHADYVKNMITGTAPLDGCILVVAANDGPMPQTREHLLLAKQIGVEHVVVYVNKA 183

  Fly   209 DAA-DEEMVDLVEMEIRELLTEMGYDGDKIPVVKGSALCALEDKSPEIGKEAILKLLQEVDSFIP 272
            ||. |.|||:|||:||||||||.||.|::.||:.||||||||.:.||:|.:::.|||..||::||
Mouse   184 DAVQDSEMVELVELEIRELLTEFGYKGEETPVIVGSALCALEQRDPELGVKSVQKLLDAVDTYIP 248

  Fly   273 TPVRELDKPFLLPVENVYSIPGRGTVVTGRLERGVVKKGMECEFVGYNKVLKSTVTGVEMFHQIL 337
            .|.|:||||||||||:|||||||||||||.||||::|||.|||.:|:||.:::.|||:||||:.|
Mouse   249 VPTRDLDKPFLLPVESVYSIPGRGTVVTGTLERGILKKGDECELLGHNKNIRTVVTGIEMFHKSL 313

  Fly   338 EEAQAGDQLGALVRGVKRDDIKRGMVMCKPGSVKALDQLEAQVYILSKDEGGRTKPFMSFIQLQM 402
            |.|:|||.|||||||:||:|::||:||.||||::...::|||||||||:||||.|||:|.....|
Mouse   314 ERAEAGDNLGALVRGLKREDLRRGLVMVKPGSIQPHQKVEAQVYILSKEEGGRHKPFVSHFMPVM 378

  Fly   403 FSRTWDCAVQVQI-PDKEMVMPGEDTKLILRLIRPMVLEQGQRFTLRDGNLTLGTGVVTSTLPPL 466
            ||.|||.|.:|.: |.||:.|||||.||.|.|.:||:||:||||||||||.|:|||:||. :|.:
Mouse   379 FSLTWDMACRVILPPGKELAMPGEDLKLSLILRQPMILEKGQRFTLRDGNKTIGTGLVTD-VPAM 442

  Fly   467 TESQRS 472
            ||..::
Mouse   443 TEEDKN 448

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mEFTu1NP_001163144.1 PRK00049 73..463 CDD:234596 270/392 (69%)
EF_Tu 81..274 CDD:206671 140/194 (72%)
EFTU_II 282..368 CDD:293898 61/86 (71%)
mtEFTU_III 371..462 CDD:294005 57/92 (62%)
TufmNP_766333.1 PRK00049 47..439 CDD:234596 270/393 (69%)
EF_Tu 56..250 CDD:206671 140/194 (72%)
G1. {ECO:0000255|PROSITE-ProRule:PRU01059} 64..71 7/7 (100%)
G2. {ECO:0000255|PROSITE-ProRule:PRU01059} 105..109 4/4 (100%)
G3. {ECO:0000255|PROSITE-ProRule:PRU01059} 126..129 3/3 (100%)
G4. {ECO:0000255|PROSITE-ProRule:PRU01059} 181..184 2/3 (67%)
G5. {ECO:0000255|PROSITE-ProRule:PRU01059} 219..221 2/2 (100%)
EFTU_II 258..344 CDD:293898 61/86 (71%)
mtEFTU_III 347..439 CDD:294005 57/93 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C166405297
eggNOG 1 0.900 E1_COG0050
Hieranoid 1 1.000
Homologene 1 1.000 H2490
Inparanoid 1 1.050 561 1.000 Inparanoid score I1080
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003422
OrthoInspector 1 1.000 T1082282
orthoMCL 1 0.900 OOG5_126954
Panther 1 1.100 LDO PTHR43721
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R370
TreeFam 00.000 Not matched by this tool.
1211.830

Return to query results.
Submit another query.