DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mEFTu1 and tufm-1

Sequence 1:NP_001163144.1 Gene:mEFTu1 FlyBaseID:FBgn0024556 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_497623.1 Gene:tufm-1 WormBaseID:WBGene00007000 Length:496 Species:Caenorhabditis elegans

Alignment Length:468 Identity:239/469 (51%)
Similarity:314/469 (67%) Gaps:31/469 (7%)


  Fly    34 RMAGATATSTACKDWQRNGLLAAPRTGNMQQYLREYANE------KKVFERTKPHCNVGTIGHVD 92
            |..|...|.|.|:.             .|||.....|..      |.||:|.|||.|||||||||
 Worm     9 RNVGVFKTVTLCEQ-------------KMQQVSLMQARHLAVPGGKAVFKRDKPHLNVGTIGHVD 60

  Fly    93 HGKTTLTAAITKVLADKQLAESKKYNEIDNAPEEKARGITINVAHVEYQTETRHYGHTDCPGHAD 157
            |||||||:||||:||..:.|:.:||.:|||||||||||||||..|:||:|..|||.|.|||||||
 Worm    61 HGKTTLTSAITKILATSKGAKYRKYEDIDNAPEEKARGITINAFHLEYETAKRHYAHIDCPGHAD 125

  Fly   158 YIKNMITGTAQMDGAILVVAATDGAMPQTREHMLLAKQIGI--DHIVVFINKVD-AADEEMVDLV 219
            ||||||||.|||:|||||||||||.|||||||:|||:|:|:  |:||||:|||| ..|.|..:||
 Worm   126 YIKNMITGAAQMEGAILVVAATDGPMPQTREHLLLARQVGVPLDNIVVFMNKVDEVPDAETRELV 190

  Fly   220 EMEIRELLTEMGYDGDKIPVVKGSALCALEDKSPEIGKEAILKLLQEVDSFIPTPVRELDKPFLL 284
            ||:|||.|.|.||.||..||:.||||||||.|.||||:||:.:||:.:|:....|.|::::..:.
 Worm   191 EMDIREQLNEFGYPGDTCPVIFGSALCALEGKQPEIGEEAVKQLLEVLDNKFVIPERKVNEEPMF 255

  Fly   285 PVENVYSIPGRGTVVTGRLERGVVKKGMECEFVGYNK---VLKSTVTGVEMFHQILEEAQAGDQL 346
            ..|:||||.|||||:||:||||::|:|.:.|.||..|   .:||.::|:|.|.:.:::|:.||||
 Worm   256 AAEHVYSIVGRGTVITGKLERGILKRGDKIEIVGGTKDGTTVKSVISGLESFRKTVDQAEPGDQL 320

  Fly   347 GALVRGVKRDDIKRGMVMCKPG-SVKALDQLEAQVYILSKDEGGRTKPFMSFIQLQMFSRTWDCA 410
            |.|:||:...|::||.|:...| ..|..|:::||:|:|.:.|||...|..::....:||.|||..
 Worm   321 GVLLRGLGPKDVRRGCVLLPQGHKHKVTDKVKAQLYVLKESEGGAKTPIANYFSEHVFSLTWDSG 385

  Fly   411 VQVQIPDKEMVMPGEDTKLILRLIRPMVLEQGQRFTLRDGNLTLGTGVVTSTLPPLTESQRSELT 475
            ..|:|..|:.|||||..::.|.|...|.:|..||||:|.|..|:||||.|..|||||..::.   
 Worm   386 ASVRIIGKDFVMPGESAEVELSLNSQMFIEPQQRFTIRKGAKTIGTGVFTDVLPPLTNDEKD--- 447

  Fly   476 EGKKAREKKVAAK 488
              .|:::|.:.|:
 Worm   448 --PKSKKKLMKAE 458

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mEFTu1NP_001163144.1 PRK00049 73..463 CDD:234596 222/397 (56%)
EF_Tu 81..274 CDD:206671 135/196 (69%)
EFTU_II 282..368 CDD:293898 40/89 (45%)
mtEFTU_III 371..462 CDD:294005 39/91 (43%)
tufm-1NP_497623.1 PRK00049 41..438 CDD:234596 222/397 (56%)
EF_Tu 49..245 CDD:206671 135/196 (69%)
EFTU_II 254..342 CDD:293898 40/88 (45%)
mtEFTU_III 346..437 CDD:294005 39/91 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C166399410
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 1 1.000 H2490
Inparanoid 1 1.050 447 1.000 Inparanoid score I901
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D298219at33208
OrthoFinder 1 1.000 FOG0003422
OrthoInspector 1 1.000 T374822
orthoMCL 1 0.900 OOG5_126954
Panther 1 1.100 LDO PTHR43721
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R370
TreeFam 00.000 Not matched by this tool.
1211.940

Return to query results.
Submit another query.