DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mEFTu1 and tufm-2

Sequence 1:NP_001163144.1 Gene:mEFTu1 FlyBaseID:FBgn0024556 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_491338.2 Gene:tufm-2 WormBaseID:WBGene00007001 Length:439 Species:Caenorhabditis elegans

Alignment Length:487 Identity:202/488 (41%)
Similarity:291/488 (60%) Gaps:62/488 (13%)


  Fly     7 AAVCRSTASMSLALRCSRRAMSSARMLRMAGATATSTACKDWQRNGL------LAAPRTGNMQQY 65
            ||:...|.|: |..|||                 ||:.|....||.:      .|.|        
 Worm     4 AALSAFTRSL-LFNRCS-----------------TSSFCNSITRNAVAFFATAAATP-------- 42

  Fly    66 LREYANEKKVFERTKPHCNVGTIGHVDHGKTTLTAAITKVLADKQLAESKKYNEIDNAPEEKARG 130
                          |.:.|||||||:||||||||:|||:|.|.|..|:..|::|||...|||.||
 Worm    43 --------------KINVNVGTIGHIDHGKTTLTSAITRVQAKKGFAKHIKFDEIDKGKEEKKRG 93

  Fly   131 ITINVAHVEYQTETRHYGHTDCPGHADYIKNMITGTAQMDGAILVVAATDGAMPQTREHMLLAKQ 195
            |||||||:.|::..|.|.|||||||:|:|||||.||:|||.|:||:|||||.|.||:||::||||
 Worm    94 ITINVAHIGYESPLRRYSHTDCPGHSDFIKNMICGTSQMDVAVLVIAATDGVMEQTKEHLILAKQ 158

  Fly   196 IGIDHIVVFINKVDAADEEMVDLVEMEIRELLTEMGYDGDKIPVVKGSALCALEDKSPEIGKE-- 258
            :|:.::.:||||.|..:|:.:||||||.||||:..|::||..||::||||.|||      |::  
 Worm   159 VGVKNMAIFINKADLVEEDDLDLVEMEARELLSLHGFNGDATPVIRGSALSALE------GQDIS 217

  Fly   259 AILKLLQEVDSFIPTPVRELDKPFLLPVENVYSIPGRGTVVTGRLERGVVKKGMECEFVGYNKVL 323
            .|.:|:..:|| :|.|.|.....|::|:.:..:|.|||||:.|.|||||:|||.:.|..|..:.|
 Worm   218 CIERLIDALDS-LPEPDRNEKDTFVMPIASKTAITGRGTVIVGTLERGVLKKGDKVEIKGDGQTL 281

  Fly   324 KSTVTGVEMFHQILEEAQAGDQLGALVRGVKRDDIKRGMVMCKPGSVKALDQLEAQVYILSKDEG 388
            ::|.:.:::|.:.::|.:|||..|.|.||||.|.:||||....||:|...::::.::|:||:.|.
 Worm   282 QTTASDIQVFGKSVKEVRAGDHCGVLCRGVKGDTVKRGMWAGHPGAVTITNRVKVELYLLSEAEN 346

  Fly   389 GRTKPFMSFIQLQMFSRTWDCAVQVQIPDKEMVMPGEDTKLILRLIRPMVLEQGQRFTLRDGN-- 451
            ||.....:....:|:..|||...:..: ..|::||||.|...:.|::.|.|.:|..||||:|:  
 Worm   347 GRKIGIRTGFTDKMYCSTWDQVGRFDM-SNELLMPGEHTSATVLLMKDMPLRKGMPFTLREGSSK 410

  Fly   452 LTLGTGVVTSTLPPLTESQRSELTEGKKAREK 483
            .|:..|:::.    |.:....|....||:.||
 Worm   411 TTIARGIISD----LEDHVAVEKHNLKKSAEK 438

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mEFTu1NP_001163144.1 PRK00049 73..463 CDD:234596 181/394 (46%)
EF_Tu 81..274 CDD:206671 111/195 (57%)
EFTU_II 282..368 CDD:293898 38/86 (44%)
mtEFTU_III 371..462 CDD:294005 27/93 (29%)
tufm-2NP_491338.2 PRK12736 43..423 CDD:237184 182/392 (46%)
EF_Tu 44..232 CDD:206671 111/195 (57%)
EFTU_II 240..326 CDD:293898 38/86 (44%)
mtEFTU_III 329..421 CDD:294005 27/97 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0050
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D298219at33208
OrthoFinder 1 1.000 FOG0003422
OrthoInspector 1 1.000 T374837
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.