DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mEFTu1 and HBS1

Sequence 1:NP_001163144.1 Gene:mEFTu1 FlyBaseID:FBgn0024556 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_001286906.1 Gene:HBS1 FlyBaseID:FBgn0042712 Length:670 Species:Drosophila melanogaster

Alignment Length:464 Identity:119/465 (26%)
Similarity:202/465 (43%) Gaps:97/465 (21%)


  Fly    63 QQYLREYANEKKVFERTKPHCNVGTIGHVDHGKTTL-------TAAITKVLADKQLAESKKYNE- 119
            |.|.:|.|::|.       |.::..|||||.||:||       |..:::.:..|...||||..: 
  Fly   235 QLYEKERADQKS-------HIHMIVIGHVDAGKSTLMGHLLYDTGNVSQRVMHKHEQESKKLGKQ 292

  Fly   120 -------IDNAPEEKARGITINVAHVEYQTETRHYGHTDCPGHADYIKNMITGTAQMDGAILVVA 177
                   :|...||:|||||::|.....:|:|:.....|.|||.|:|.|||:|..|.|.|:|||.
  Fly   293 SFMYAWVLDETGEERARGITMDVGQSRIETKTKIVTLLDAPGHKDFIPNMISGATQADVALLVVD 357

  Fly   178 ATDGAMP-------QTREHMLLAKQIGIDHIVVFINKVDA---ADEEMVDLVEMEIRELLTEMGY 232
            ||.|...       |||||.:|.:.:|::.:.|.|||:|.   :.:...::| .:::..|...|:
  Fly   358 ATRGEFESGFELGGQTREHAILVRSLGVNQLGVVINKLDTVGWSQDRFTEIV-TKLKSFLKLAGF 421

  Fly   233 DGDKIPVVKGSALCALEDKSPEIGKEAILK------LLQEVDSFIPTPVRELDKPFLLPVENVYS 291
            ....:.....|.|.. |:.:.:..:.|:..      ||..:::| ..|.|.:|:|..:.|.::|.
  Fly   422 KDSDVSFTPCSGLTG-ENLTKKAQEPALTNWYSGRHLLDVIENF-KIPERAIDRPLRMSVSDIYK 484

  Fly   292 IPGRGTVVTGRLERGVVKKGMECEFVGYNKVLKSTVTGVEMFHQILEEAQ--------------- 341
            ..|.|..::||:|.||:...        :|||    .|...     |:||               
  Fly   485 GTGSGFCISGRVETGVLCLN--------DKVL----VGASR-----EQAQVKSLTMNEFPQTCVF 532

  Fly   342 AGDQLGALVRGVKRDDIKRGMVMCKPGS-VKALDQLEAQVYILSKDEGGRTKPFMSFIQLQMFSR 405
            ||||:...:..:..:::..|.::..|.: :....:.:|::.:.:.    :....|.|..|.....
  Fly   533 AGDQVSVTLPALDINNVTVGCIISDPQTPIPVTTRFQARIIVFNV----KVPITMGFPVLLHHQS 593

  Fly   406 TWDCAVQVQIPDKEMVMPGEDTK-------------LILRLIRPMVLEQGQ------RFTLRDGN 451
            ..:.||..::........||..|             :.|...||:.:|:..      |..||...
  Fly   594 LIEPAVVCKLTASIHKSTGEVVKKKPRCLGNNSCALVELETSRPICIERYADFKELGRVMLRVAG 658

  Fly   452 LTLGTGVVT 460
            :|:..|:||
  Fly   659 VTIAAGMVT 667

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mEFTu1NP_001163144.1 PRK00049 73..463 CDD:234596 115/455 (25%)
EF_Tu 81..274 CDD:206671 68/224 (30%)
EFTU_II 282..368 CDD:293898 22/101 (22%)
mtEFTU_III 371..462 CDD:294005 20/110 (18%)
HBS1NP_001286906.1 HBS1_N 83..145 CDD:286079
TEF1 241..669 CDD:227581 116/459 (25%)
EF1_alpha 249..468 CDD:206670 68/222 (31%)
HBS1-like_II 474..557 CDD:293912 22/100 (22%)
HBS1_C_III 561..669 CDD:294008 20/112 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C87653077
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.