DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpp30 and rpp30

DIOPT Version :8

Sequence 1:NP_001259808.1 Gene:Rpp30 / 44392 FlyBaseID:FBgn0283652 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001016584.1 Gene:rpp30 / 549338 XenbaseID:XB-GENE-993926 Length:265 Species:Xenopus tropicalis

Alignment Length:247 Identity:81/248 (33%)
Similarity:125/248 (50%) Gaps:15/248 (6%)


  Fly     7 FYDFSIPYNKDDSVLRALLNELVETGYKTVAIDQ--SFDHSKKDPGKRGS--EMFPEPHKIEHLR 67
            |.|.:|...||...|:.::......||.||||:.  .|:..|.:.||..|  |:|.....:    
 Frog     4 FVDLNITNCKDVKKLQNMIEMAAHLGYSTVAINHVFEFESKKMEIGKPISTKELFSTLPTV---- 64

  Fly    68 KEFQDK---LRILQRITILYVDVNVAHAM-SVSHNLRKFNLIAGQPKTDAALTHCCTAFNGDLIT 128
               |.|   ::||.|:||:..|.:..:.: |.|.:.|.::::|..|||:......||:.:.|||.
 Frog    65 ---QGKSIPIKILTRLTIIASDPSHCNVLRSTSPSTRLYDIVAVFPKTEKLFHAACTSIDVDLIC 126

  Fly   129 FDPVAGSRLLVNRKAYQVAVRRGMFFEIKYAPSICDSNNRKDMIKIAQNYCTKGKSKNVIFSSGA 193
            .:....:.....|.....|::||:|||:.|.|:|.||..|:..|..|.:.....|.||:|.||||
 Frog   127 INVTEKAPFFFRRPPINAAIQRGIFFELVYTPAIKDSTLRRYTISNALSLMQVCKGKNIIISSGA 191

  Fly   194 AHEFQLRGPYDVANLAFIFGLSEDQGKNAVDGHCRELFLKAEARRLGKTIMF 245
            ....::|||||:|.|..:|||:|...|.||..:||...|..|.|:....:::
 Frog   192 ERALEMRGPYDIATLGLLFGLTEGVAKAAVSTNCRSAVLHGETRKTAFGVVY 243

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rpp30NP_001259808.1 RNase_P_p30 8..226 CDD:280117 75/226 (33%)
rpp30NP_001016584.1 RNase_P_p30 5..224 CDD:280117 75/226 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C237499331
eggNOG 1 0.900 E1_COG1603
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H38180
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004258
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
65.700

Return to query results.
Submit another query.