DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tim17b2 and TIM17-1

Sequence 1:NP_001285956.1 Gene:Tim17b2 FlyBaseID:FBgn0020371 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_173460.1 Gene:TIM17-1 AraportID:AT1G20350 Length:218 Species:Arabidopsis thaliana

Alignment Length:178 Identity:85/179 (47%)
Similarity:112/179 (63%) Gaps:10/179 (6%)


  Fly     3 EYSREPCPHRIVDDCGGAFIMGCVGGGLFQGLKGFRNAPQGLGRRVAGSVAAIKTKSPVIGGSFA 67
            |.||||||.||:||.||||.||.|||..:..::|..|:|.  |.|::|.|.|::...|..||||:
plant     5 ESSREPCPDRILDDVGGAFAMGAVGGSAYHLIRGIYNSPG--GARLSGGVQALRMSGPRSGGSFS 67

  Fly    68 AWGAVFSIVDCSLVHFRQKEDPWNSIVSGAVTGGILASRNGAAAMAGSAIIGGVLLSMIEGLGIF 132
            .||.::|..||:||:.||||||||||:|||.|||.|:.|.|..|.|.||::|||||:||||:||.
plant    68 VWGGLYSTFDCALVYARQKEDPWNSILSGAATGGFLSLRQGLGASARSALVGGVLLAMIEGVGIM 132

  Fly   133 FTRFAA----EQFRNREPHIMPDANEGYGDFNSSGFGFPGAQQATATS 176
            ..:..:    |||  .|.|.......|.|..  ||...|..:.::::|
plant   133 LNKVQSTAHNEQF--MEDHAATSLPYGMGQI--SGQSVPVPETSSSSS 176

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tim17b2NP_001285956.1 Tim17 1..151 CDD:295283 79/152 (52%)
TIM17-1NP_173460.1 Tim17 7..148 CDD:295283 77/145 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 168 1.000 Inparanoid score I1516
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1590221at2759
OrthoInspector 1 1.000 T32219
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10485
Phylome 1 0.910 0.800 Consistency score
66.070

Return to query results.
Submit another query.