DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tim17b2 and timm-17B.1

Sequence 1:NP_001285956.1 Gene:Tim17b2 FlyBaseID:FBgn0020371 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_500627.1 Gene:timm-17B.1 WormBaseID:WBGene00017119 Length:181 Species:Caenorhabditis elegans

Alignment Length:171 Identity:80/172 (47%)
Similarity:109/172 (63%) Gaps:4/172 (2%)


  Fly     1 MEEYSREPCPHRIVDDCGGAFIMGCVGGGLFQGLKGFRNAPQGLGRRVAGSVAAIKTKSPVIGGS 65
            ||||:|||||:||.||.|.||.||.|||.:||...|::||.:  |:::.|.:..::.:|.:.|..
 Worm     1 MEEYTREPCPYRIGDDIGSAFAMGLVGGSIFQAFGGYKNAAK--GKKLVGMMREVRMRSTLTGVQ 63

  Fly    66 FAAWGAVFSIVDCSLVHFRQKEDPWNSIVSGAVTGGILASRNGAAAMAGSAIIGGVLLSMIEGLG 130
            |||||.:||.:||.||..|:||||.||||||.:||.:||.|:|...||||||:|.|:|:||||:|
 Worm    64 FAAWGGMFSTIDCCLVAIRKKEDPINSIVSGGLTGALLAIRSGPKVMAGSAILGSVILAMIEGVG 128

  Fly   131 IFFTRFAAEQFRNREPHIMPDANEGYGDFNSSGFGFPGAQQ 171
            :..||:........:|  .|:|.:............||..|
 Worm   129 LVTTRWMGAMMDPTQP--PPEALDDPRSLGQKSQAEPGLDQ 167

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tim17b2NP_001285956.1 Tim17 1..151 CDD:295283 76/150 (51%)
timm-17B.1NP_500627.1 3a0801so1tim17 1..172 CDD:130053 80/172 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C274751915
eggNOG 1 0.900 E1_COG5596
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 173 1.000 Inparanoid score I2685
Isobase 1 0.950 0 Normalized mean entropy S575
OMA 1 1.010
OrthoDB 1 1.010 D1590221at2759
OrthoFinder 1 1.000 FOG0000724
OrthoInspector 1 1.000 T374984
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10485
Phylome 1 0.910 0.750 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.860

Return to query results.
Submit another query.