DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Shark and sem-5

DIOPT Version :10

Sequence 1:NP_524743.2 Gene:Shark / 44353 FlyBaseID:FBgn0015295 Length:939 Species:Drosophila melanogaster
Sequence 2:NP_509342.1 Gene:sem-5 / 181055 WormBaseID:WBGene00004774 Length:228 Species:Caenorhabditis elegans


Alignment Length:120 Identity:31/120 - (25%)
Similarity:55/120 - (45%) Gaps:32/120 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSRDSDP-----------------------MKWYHGNLSREAADELLKQ-GYEDGTFLVRESSTA 41
            :::|.||                       ..||.|.::|..|:.|||: ...||.||||:..::
 Worm    28 LNKDEDPHWYKAELDGNEGFIPSNYIRMTECNWYLGKITRNDAEVLLKKPTVRDGHFLVRQCESS 92

  Fly    42 AGDFVLSLLCQGEVCHYQV-RRHGGEDAFFSIDDKVQTKILHGLDTLVDYYQQAA 95
            .|:|.:|:..|..|.|::| |...|:...:::.       .:.|:.||.|::.|:
 Worm    93 PGEFSISVRFQDSVQHFKVLRDQNGKYYLWAVK-------FNSLNELVAYHRTAS 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SharkNP_524743.2 SH2_Nterm_shark_like 8..91 CDD:198210 26/84 (31%)
ANKYR <94..317 CDD:440430 1/2 (50%)
ANK repeat 124..151 CDD:293786
ANK repeat 153..184 CDD:293786
ANK repeat 186..217 CDD:293786
ANK repeat 220..245 CDD:293786
SH2_Cterm_shark_like 287..395 CDD:198211
PTKc_Syk_like 666..926 CDD:270650
sem-5NP_509342.1 SH3_GRB2_like_N 2..53 CDD:212738 3/24 (13%)
SH2_Grb2_like 56..151 CDD:199828 28/92 (30%)
SH3_GRB2_like_C 158..210 CDD:212739
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.