DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: pie and KMT2B

Sequence 1:NP_001260348.1 Gene:pie FlyBaseID:FBgn0005683 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_055542.1 Gene:KMT2B HGNCID:15840 Length:2715 Species:Homo sapiens

Alignment Length:525 Identity:110/526 (21%)
Similarity:163/526 (31%) Gaps:164/526 (31%)


  Fly     1 MEDNKELQCLIC-KYSDTDDLVFGEWMIV-RNLQVHYFCLLLSTHLPQRGGDSSGILGFLLRDIR 63
            :||.:  ||.:| ||.|.|....|..:.: :|...|..|.:.|..:.:....|       |:::.
Human  1575 LEDPR--QCALCLKYGDADSKEAGRLLYIGQNEWTHVNCAIWSAEVFEENDGS-------LKNVH 1630

  Fly    64 EEAAAAEKRKCWYCNKIGASLQC--DRCRSLFHLKCGLENRAVFEFCGQYKSYCYKCRPMDDYKR 126
            ...|...:.:|..|.|.||::.|  ..|.|.||..|...:..:|:  ...|.:|.|...:.|.|.
Human  1631 AAVARGRQMRCELCLKPGATVGCCLSSCLSNFHFMCARASYCIFQ--DDKKVFCQKHTDLLDGKE 1693

  Fly   127 QLQSNPPRNATCPICFSSIYKVELHCVVYGDCCRLGFAHKKCMRQYALTSGYYLRCIWCRSERFR 191
            .:.         |..|..:.:      ||.|...:.|..|       ..:|.....|    ....
Human  1694 IVN---------PDGFDVLRR------VYVDFEGINFKRK-------FLTGLEPDAI----NVLI 1732

  Fly   192 DSIRLQSVFVPDRDATWEKQRNAYRELHERNLKCDQPNC---LCPSGRTYNRLSWVILCCSSCAA 253
            .|||:.|:                      ....|..:|   |.|.|...:||.|        :.
Human  1733 GSIRIDSL----------------------GTLSDLSDCEGRLFPIGYQCSRLYW--------ST 1767

  Fly   254 TSAHLKCLVGALRLPKKRERTDFKCSMCLDVERRIAE----GPARTTEETNADGDNQVDGSFYVQ 314
            ..|..:|.              ::|        ||.|    ||........|..:||        
Human  1768 VDARRRCW--------------YRC--------RILEYRPWGPREEPAHLEAAEENQ-------- 1802

  Fly   315 KLGPDAATRSLTQTPVFSEE---DESERSSNITVIFSQPKSNATSERLSLSPPQEEMIVEIPDSP 376
                     ::..:|..|.|   .|........::...|:.::..:  :|.||..      |||.
Human  1803 ---------TIVHSPAPSSEPPGGEDPPLDTDVLVPGAPERHSPIQ--NLDPPLR------PDSG 1850

  Fly   377 EASPKTSID--------ENHSP--QPIARRDTSDSPQPIAASEI---------PDSPQPTAASEI 422
            .|.|.....        .|:||  :|:........|.|.:.|.:         ||.|.|...|. 
Human  1851 SAPPPAPRSFSGARIKVPNYSPSRRPLGGVSFGPLPSPGSPSSLTHHIPTVGDPDFPAPPRRSR- 1914

  Fly   423 PDLPQTTAINVNPELTQQTALNTIPHSPQ----PEASFSTQLVSQTFDCPQPQEQAVAKAPNSPS 483
              .|...|....|.......|.|   |||    |..|..|.|...:.:...|     ..||:.| 
Human  1915 --RPSPLAPRPPPSRWASPPLKT---SPQLRVPPPTSVVTALTPTSGELAPP-----GPAPSPP- 1968

  Fly   484 LPKED 488
             |.||
Human  1969 -PPED 1972

Known Domains:


GeneSequenceDomainRegion External IDIdentity
pieNP_001260348.1 PHD_SF 9..117 CDD:304600 28/112 (25%)
PHD_SF 224..>260 CDD:304600 9/39 (23%)
PARM 318..>491 CDD:293666 44/198 (22%)
KMT2BNP_055542.1 zf-CXXC 958..1005 CDD:251032
PHD1_KMT2B 1203..1249 CDD:277064
PHD2_KMT2B 1251..1300 CDD:277066
PHD3_KMT2B 1337..1393 CDD:277068
Bromo_ALL-1 1374..1516 CDD:99925
ePHD_KMT2B 1581..1685 CDD:277164 29/113 (26%)
FYRN 1734..1780 CDD:283589 16/98 (16%)
FYRC 2413..2497 CDD:197781
SET <2559..2715 CDD:225491
SET 2577..2697 CDD:214614
S-adenosyl-L-methionine binding. {ECO:0000250} 2652..2653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG1084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.