DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: pie and phf6

Sequence 1:NP_001260348.1 Gene:pie FlyBaseID:FBgn0005683 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_001107695.1 Gene:phf6 XenbaseID:XB-GENE-999439 Length:363 Species:Xenopus tropicalis

Alignment Length:310 Identity:72/311 (23%)
Similarity:117/311 (38%) Gaps:83/311 (27%)


  Fly     4 NKELQCLICKYSDTDDLVFGEWMIVRNLQV--HYFCLLLSTHLPQRGGDSSGILGFLLRDIREEA 66
            |:|.:|             |:.:|..|.:|  |:.|:|.|:.|.....||..:.||.:.||::|.
 Frog    23 NREKEC-------------GQLLISSNQKVAAHHRCMLFSSALVSSQSDSENLGGFSIEDIQKEL 74

  Fly    67 AAAEKRKCWYCNKIGASLQCD--RCRSLFHLKCGLENRAVFE---FCGQYKSYCYKCRPMDDYKR 126
            ....|..|..|:..||::.||  .|...:|..|.|.::|..:   ..|.|..:|.|      :|.
 Frog    75 KRGRKLMCSLCHCPGATIGCDVKSCHRTYHYHCALRDKAHIQENPSQGMYTIFCRK------HKE 133

  Fly   127 QLQSNPPRNATCPICFSSIYKVELHCVVYGDCCRLGFAHK----KCMRQYALTSGYYLRCIWCRS 187
            |:|::..               ||.    |...|.|.|.:    :..|..:.||         .|
 Frog   134 QVQNSDD---------------ELE----GSFTRRGLAPQRGRGRGSRGKSRTS---------NS 170

  Fly   188 ERFRDSIRLQSVFVPDRDATWEKQRNAYRELHERNLKCDQPNC-LCPSGRTYNRLSWVILCCSSC 251
            ....:..||.|:...:..   |...:..|..|..:....:|.| .|.:|...|.....:...::.
 Frog   171 RGQSEESRLSSLHCTEET---ESSSSRDRSPHRSSPSDTRPKCGFCHAGDEENETRGKLHVFNAK 232

  Fly   252 AATSAHLKCLV---GALRL--PKKRERTDF---------------KCSMC 281
            .| :||.||::   |.::|  ..:.|..||               ||::|
 Frog   233 KA-AAHYKCMLFSSGTVQLTTTSRAEFGDFDIKTVIQEMKRGKRMKCTLC 281

Known Domains:


GeneSequenceDomainRegion External IDIdentity
pieNP_001260348.1 PHD_SF 9..117 CDD:304600 32/115 (28%)
PHD_SF 224..>260 CDD:304600 9/37 (24%)
PARM 318..>491 CDD:293666
phf6NP_001107695.1 ePHD1_PHF6 17..131 CDD:277180 35/127 (28%)
ePHD2_PHF6 210..327 CDD:277181 17/74 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C63775890
eggNOG 1 0.900 E2759_KOG1084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.790

Return to query results.
Submit another query.