DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: pie and TCF20

Sequence 1:NP_001260348.1 Gene:pie FlyBaseID:FBgn0005683 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_005641.1 Gene:TCF20 HGNCID:11631 Length:1960 Species:Homo sapiens

Alignment Length:246 Identity:49/247 (20%)
Similarity:79/247 (32%) Gaps:89/247 (36%)


  Fly   283 DVERRIAE------GPA-----------RTTEETNADGDNQVDGSFYVQ-----KLGPDAATRSL 325
            |:|:|..|      .||           |::||.....|::|....:.:     |..|.|.|.:.
Human  1404 DIEKRKGEVASDLVSPANQELHVEKPLPRSSEEWRGSVDDKVKTETHAETVTAGKEPPGAMTSTT 1468

  Fly   326 TQTPVFSE-EDESERSSNITVIFSQPKSNATSERLSLSPPQEEMIVEIPDSPEASPKTSIDENH- 388
            :|.|..:: ..:........:||...|:         .||...:      :|||:||....||. 
Human  1469 SQKPGSNQGRPDGSLGGTAPLIFPDSKN---------VPPVGIL------APEANPKAEEKENDT 1518

  Fly   389 ---SP------------------QPIARRDTSDSPQPIAASEIPDSPQPTAASEIPDLPQTTA-- 430
               ||                  :||.    |.:.|.......|..|||      |.:|:.:|  
Human  1519 VTISPKQEGFPPKGYFPSGKKKGRPIG----SVNKQKKQQQPPPPPPQP------PQIPEGSADG 1573

  Fly   431 -----------------INVNPELTQQTALNTIPHSPQPEASFSTQLVSQT 464
                             .......|:|......|..|:.:..::||.:.:|
Human  1574 EPKPKKQRQRRERRKPGAQPRKRKTKQAVPIVEPQEPEIKLKYATQPLDKT 1624

Known Domains:


GeneSequenceDomainRegion External IDIdentity
pieNP_001260348.1 PHD_SF 9..117 CDD:304600
PHD_SF 224..>260 CDD:304600
PARM 318..>491 CDD:293666 37/190 (19%)
TCF20NP_005641.1 Leucine-zipper 1170..1191
Nuclear localization signal. {ECO:0000250} 1254..1268
Nuclear localization signal. {ECO:0000250} 1576..1600 1/24 (4%)
ePHD_TCF20 1705..1932 CDD:277169
Nuclear localization signal. {ECO:0000250} 1785..1792
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG1084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.