DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: pie and phf11

Sequence 1:NP_001260348.1 Gene:pie FlyBaseID:FBgn0005683 Length:582 Species:Drosophila melanogaster
Sequence 2:XP_021334650.1 Gene:phf11 ZFINID:ZDB-GENE-081104-417 Length:531 Species:Danio rerio

Alignment Length:520 Identity:118/521 (23%)
Similarity:185/521 (36%) Gaps:153/521 (29%)


  Fly     9 CLICKYSDTDDLVFGEWMIVRNLQVHYFCLLLSTHLPQRGGDS-SGILGFLLRDIREEAAAAEKR 72
            |.:||.||..:.. |......::..|..|||.|:::..:...: ..:.||.|.|:::|....:|.
Zfish    14 CALCKTSDETETT-GPLSSKEDISAHQNCLLFSSNIYCKNSPTYDDLFGFDLEDVKKEQRRGQKL 77

  Fly    73 KCWYCNKIGASLQCD--RCRSLFHLKCGL--ENRAVFEF-CGQYKSYCYKCRP--------MDD- 123
            :|::|||.||::.|:  ||...||..|.:  :.||:.:| .|.|:.||....|        :|: 
Zfish    78 RCYFCNKTGATVGCEIKRCPRSFHYPCAIKADARAIEDFSTGTYRVYCKSHDPNPIEINDEIDND 142

  Fly   124 -------------YKRQLQSNPPRNATCPICFSSIYKVELHCVVYG----DCCRLGFAHKKCMRQ 171
                         .::..||.|....|.|   |...|........|    |....|.|.|     
Zfish   143 VDLVLASVEKHVPAEQHNQSTPDPERTRP---SEEVKTPAKASSNGGLTSDQRSCGTADK----- 199

  Fly   172 YALTSGYYLRCIWCRSE----------RFRDSIRLQSVFVPDR------DATWEKQRNAYRELHE 220
                     |.|.|.|:          :.:...||:   .||.      ||....:.:|    .|
Zfish   200 ---------RRIECDSQEHSPEHKTPTKKKKKRRLE---YPDNENPTSADAVMAPEVSA----PE 248

  Fly   221 RNLKCDQPNCLCP---SGRTYNRLSWVILCCSSCAATSAHLKCLVGALRLPKKRERTDFKCSMCL 282
            .::..:|||...|   :.|:..:|:   |..:..||..              :.:.||.: |:.|
Zfish   249 ESMTVNQPNHSTPLPENTRSCEKLN---LSTTGAAADD--------------EDDETDIE-SVSL 295

  Fly   283 DV-----ERRIAEGPARTTEETNADGDNQVDGSFYVQKLGPDAATRSLTQTPVFSEEDESERSSN 342
            .|     .|.|.|..:..|.||:                 |......|...|....|...|..| 
Zfish   296 SVLNKTHLRHIEESQSVLTYETD-----------------PVPCIVILDSGPSLESEISLESCS- 342

  Fly   343 ITVIFSQPKSNATSERLSLSPPQEEMIVEIPDSPEASP--KTSIDENHSPQPIA--RRDTSDSPQ 403
                             |.:|......|.:|...:.:|  :||..:..:||..|  ::..||.| 
Zfish   343 -----------------SRNPSPAHEFVTVPKQEKITPTDRTSPAQTVTPQVPAPNQKRVSDGP- 389

  Fly   404 PIAASEIPDSPQPTAA---SEIPDLPQTTAINVN------PELTQQTALNTIPHSPQPEASFSTQ 459
                |..|..|.|||.   |.:..|.| :||...      .|::...:.:|:|:.....|.|.|:
Zfish   390 ----SVSPQHPSPTAGLRISAVCTLAQ-SAIKKEQLSDPPAEVSTSDSQSTVPNCQTRAAKFWTR 449

  Fly   460  459
            Zfish   450  449

Known Domains:


GeneSequenceDomainRegion External IDIdentity
pieNP_001260348.1 PHD_SF 9..117 CDD:304600 36/114 (32%)
PHD_SF 224..>260 CDD:304600 9/39 (23%)
PARM 318..>491 CDD:293666 36/156 (23%)
phf11XP_021334650.1 ePHD_PHF6_like 14..128 CDD:277143 36/115 (31%)
Herpes_BLLF1 <228..445 CDD:330317 60/280 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C63727941
eggNOG 1 0.900 E2759_KOG1084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12420
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
54.800

Return to query results.
Submit another query.