DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: pie and si:ch211-37e10.1

Sequence 1:NP_001260348.1 Gene:pie FlyBaseID:FBgn0005683 Length:582 Species:Drosophila melanogaster
Sequence 2:XP_017209386.2 Gene:si:ch211-37e10.1 ZFINID:ZDB-GENE-131127-547 Length:661 Species:Danio rerio

Alignment Length:257 Identity:55/258 (21%)
Similarity:80/258 (31%) Gaps:79/258 (31%)


  Fly   264 ALRLPKKRERTDFKCSMCLDVERR---IAEGPARTTEETNADG----DNQVDGSF---------Y 312
            :||..::::|...:.|..  .|||   |.|...||.||. |||    ....||:.         .
Zfish    63 SLRADQEKDRRTEEISQY--EERRLKIIQERLMRTNEEP-ADGIPLKFTFPDGTMKIRRFQVFDQ 124

  Fly   313 VQKLGPDAATRSLTQTPVFSEEDESERSSNITV---------------------------IFSQP 350
            :|.|.....|.|......:.:|..|..|.:.||                           :|.|.
Zfish   125 IQALFDFVGTHSSATEYFYIKEATSAVSISSTVPGTLLDHYLNAPLNIHVRWMEMEDVQALFHQQ 189

  Fly   351 KSNATSERLSLSPPQEEMIVEIPDSPEASPKTSIDENHSPQPIARRDTSDSPQPIA-----ASEI 410
            .|      :.|..|.|....|:.|..|.....:.||.||...:...|:....:..:     .||.
Zfish   190 NS------VLLPSPDELETSEVQDDLETVESVTPDEIHSQDDMEIMDSGSREEMYSNHRENVSET 248

  Fly   411 PDSPQPTAASEIPDLPQTTAINVNPELTQQTALNTIP------HSPQPEASFSTQLVSQTFD 466
            .||.        |:: .....|:.|:       |.:|      |....|..:....|..|.|
Zfish   249 VDSG--------PEI-YNNYNNIMPD-------NDLPEPDDQDHQDGSEVMYLEDFVGSTED 294

Known Domains:


GeneSequenceDomainRegion External IDIdentity
pieNP_001260348.1 PHD_SF 9..117 CDD:304600
PHD_SF 224..>260 CDD:304600
PARM 318..>491 CDD:293666 35/188 (19%)
si:ch211-37e10.1XP_017209386.2 UBQ 105..>142 CDD:320785 6/37 (16%)
HECTc 309..659 CDD:331829
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C63790284
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.