DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: pie and si:ch211-165g14.1

Sequence 1:NP_001260348.1 Gene:pie FlyBaseID:FBgn0005683 Length:582 Species:Drosophila melanogaster
Sequence 2:XP_689373.2 Gene:si:ch211-165g14.1 ZFINID:ZDB-GENE-131127-601 Length:672 Species:Danio rerio

Alignment Length:344 Identity:73/345 (21%)
Similarity:116/345 (34%) Gaps:97/345 (28%)


  Fly   249 SSCAATSAHLKCLVGALRLPKKRERTDFKCSMCLDVERRIAEGPARTTEETNADGDNQ-----VD 308
            ||.||.:.|        ......|:|        .:|...:|....:||.|::|.|:.     |.
Zfish   175 SSAAANTLH--------STSSAAEQT--------AIETLASECTKTSTESTSSDADSDIIEVPVS 223

  Fly   309 GSFYVQK--LGP--------DAATRSLTQTPVFSEEDESERSS----NIT-------VIFSQPKS 352
            .|....:  |.|        |.:.|:|..:.:..:.|...:.:    |:.       .:|.....
Zfish   224 NSRCTTRPNLRPRPTSVIVSDTSGRTLRSSRLKQQVDADHQMNFSPKNVNSVYTMDEAVFETANH 288

  Fly   353 NATSERLSLSPPQEEMIVEIPDSPEAS------------PKTSIDENHS--PQPIARRDTSDSPQ 403
            ...||..||....|.::  ||.|||.|            |.||..||.|  ..|..||.:|.:|.
Zfish   289 RVGSESKSLLSWMESVL--IPISPEDSEQDTNSSFPKNFPSTSDAENSSILRSPENRRSSSSTPS 351

  Fly   404 -----PIAASEIPDSPQPTAASEIPDLP--QTTAINVNPELTQQTALNTIPHSPQPEASFSTQLV 461
                 |.:.|.....|:|....:....|  |.......|:.|::..    ...|||...      
Zfish   352 HQERTPPSKSRKRAKPRPKPRPKPRPKPKKQPKRAAPGPKTTKKRR----RRKPQPSGP------ 406

  Fly   462 SQTFDCPQPQEQAVAKAPNSPSLPKEDPNTLLVLKSGFQCPGEPFFYLVIYEFEHGTCMGECIGT 526
            |..|...:|:.:  .|..|..|..||       :::...|      ::.....|..:|       
Zfish   407 SSMFSPKEPEIK--LKFANHKSEKKE-------VRTAVHC------FVPYIRMEFSSC------- 449

  Fly   527 CVLRFKEDDPRIQDTSQAA 545
            .::.|:|::...:..||.|
Zfish   450 TIVNFREEEVASKKGSQLA 468

Known Domains:


GeneSequenceDomainRegion External IDIdentity
pieNP_001260348.1 PHD_SF 9..117 CDD:304600
PHD_SF 224..>260 CDD:304600 5/11 (45%)
PARM 318..>491 CDD:293666 48/213 (23%)
si:ch211-165g14.1XP_689373.2 PHD_SF 496..657 CDD:304600
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG1084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.