DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: pie and Tcf20

Sequence 1:NP_001260348.1 Gene:pie FlyBaseID:FBgn0005683 Length:582 Species:Drosophila melanogaster
Sequence 2:XP_006242172.1 Gene:Tcf20 RGDID:1594486 Length:1992 Species:Rattus norvegicus

Alignment Length:408 Identity:81/409 (20%)
Similarity:128/409 (31%) Gaps:155/409 (38%)


  Fly   202 PDRDATWEKQRNAYREL-HERNLKC--------DQPNCLCPSGRTYNRLSWVILCCSSCAATS-- 255
            |.::.. :|..|:|..| |.:::|.        |.||   |..|.          |.:...||  
  Rat  1319 PSKEGA-DKVYNSYSHLSHSQDIKSIPKRDASKDLPN---PDNRN----------CPAVTLTSPA 1369

  Fly   256 ------------AHLKCLVGALRLPKKRERTDFKC------SMCLDVERRIAEGP---------- 292
                        ..|:.:|..:..|..|.......      ::.||....:..||          
  Rat  1370 KTKILPPRKGRGLKLEAIVQKITSPNIRRSASANSAETGGDTVTLDDILSLKSGPPEGGTVANQE 1434

  Fly   293 ---------------ARTTEETNAD-------------GDNQVDGSFYVQKLGPDAATRSLTQTP 329
                           :.|.:|:|.:             ||::|....:|:       |.|..:.|
  Rat  1435 AEMEKRKGEVVSDLVSATNQESNVEKPLPGPSEEWRGSGDDKVKTEAHVE-------TASTGKEP 1492

  Fly   330 VFSEEDESERSSNITVIFSQ-PKSNATSERLSL--SPPQEEMIVEIPDS----------PEASPK 381
                      |..:|...|| |..|......||  :.|     :..|||          |||:||
  Rat  1493 ----------SGTMTSTASQKPGGNQGRPDGSLGGAAP-----LIFPDSKNVAPVGILTPEANPK 1542

  Fly   382 TSIDENHSPQPIARRDTSDSP-----------QPIAA--------SEIPDSPQPTAASEIPDLPQ 427
            |...||.:.. |:.:..|..|           :||.:        .:.|..|||      |.:|:
  Rat  1543 TEEKENDTVM-ISPKQESFPPKGYFPSGKKKGRPIGSVNKQKKQQQQPPPPPQP------PQMPE 1600

  Fly   428 TTAINVNPELTQQTALNTIPHSPQPEASFSTQLVSQTFDCPQPQEQAVAKAPNSPSLPKEDPNTL 492
            .:| :..|:..:|....   ...:|.|....:...|.....:|||..:.....:..|.|.|... 
  Rat  1601 GSA-DGEPKPKKQRQRR---ERRKPGAQPRKRKTKQAVPIVEPQEPEIKLKYATQPLDKTDAKN- 1660

  Fly   493 LVLKSGFQCPGEPFFYLV 510
               ||.|     |:.::|
  Rat  1661 ---KSFF-----PYIHVV 1670

Known Domains:


GeneSequenceDomainRegion External IDIdentity
pieNP_001260348.1 PHD_SF 9..117 CDD:304600
PHD_SF 224..>260 CDD:304600 10/58 (17%)
PARM 318..>491 CDD:293666 46/205 (22%)
Tcf20XP_006242172.1 ePHD_TCF20 1737..1964 CDD:277169
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG1084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.