DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Vha16-1 and VMA3

Sequence 1:NP_476801.1 Gene:Vha16-1 FlyBaseID:FBgn0262736 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_010887.3 Gene:VMA3 SGDID:S000000753 Length:160 Species:Saccharomyces cerevisiae

Alignment Length:150 Identity:110/150 (73%)
Similarity:131/150 (87%) Gaps:2/150 (1%)


  Fly    10 PIYGPFFGVMGAASAIIFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIYGLVV 74
            |:|.||||.:|.||||||::|||||||||||.||.|..|:||:|:.|:|:||:||||||||||||
Yeast     6 PVYAPFFGAIGCASAIIFTSLGAAYGTAKSGVGICATCVLRPDLLFKNIVPVIMAGIIAIYGLVV 70

  Fly    75 AVLIAGALEEPSKYSLYRGFIHLGAGLAVGFSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILIL 139
            :||:..:|.:  |.:||.|||.|||||:||.|||||||||||||||||||::|||||||||||||
Yeast    71 SVLVCYSLGQ--KQALYTGFIQLGAGLSVGLSGLAAGFAIGIVGDAGVRGSSQQPRLFVGMILIL 133

  Fly   140 IFAEVLGLYGLIVAIYLYTK 159
            ||||||||||||||:.|.::
Yeast   134 IFAEVLGLYGLIVALLLNSR 153

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Vha16-1NP_476801.1 PRK06558 13..159 CDD:235830 108/146 (74%)
V_ATP_synt_C 15..122 CDD:130170 76/107 (71%)
ATP-synt_C 96..156 CDD:278563 53/60 (88%)
VMA3NP_010887.3 V_ATP_synt_C 11..116 CDD:130170 76/107 (71%)
ATP-synt_C 91..150 CDD:306615 53/59 (90%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C251507186
eggNOG 1 0.900 E1_COG0636
Hieranoid 1 1.000
Homologene 1 1.000 H68199
Inparanoid 1 1.050 217 1.000 Inparanoid score I774
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001016
OrthoInspector 1 1.000 T634547
orthoMCL 1 0.900 OOG5_126803
Panther 1 1.100 LDO PTHR10263
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1636
TreeFam 1 0.960
1312.790

Return to query results.
Submit another query.