DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Vha16-1 and VMA16

Sequence 1:NP_476801.1 Gene:Vha16-1 FlyBaseID:FBgn0262736 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_011891.1 Gene:VMA16 SGDID:S000001068 Length:213 Species:Saccharomyces cerevisiae

Alignment Length:147 Identity:51/148 (34%)
Similarity:80/148 (54%) Gaps:6/148 (4%)


  Fly    19 MGAASAIIFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIYGLVVAVL------ 77
            :|.|..:..|.:|||:|...:|:.:....|..|.:..|::|.::...::|||||::|::      
Yeast    62 LGIALCVGLSVVGAAWGIFITGSSMIGAGVRAPRITTKNLISIIFCEVVAIYGLIIAIVFSSKLT 126

  Fly    78 IAGALEEPSKYSLYRGFIHLGAGLAVGFSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFA 142
            :|.|....||.:||.|:....||:.||.|.|..|.|:||.|.......|....|||.:::|.||.
Yeast   127 VATAENMYSKSNLYTGYSLFWAGITVGASNLICGIAVGITGATAAISDAADSALFVKILVIEIFG 191

  Fly   143 EVLGLYGLIVAIYLYTK 159
            .:|||.||||.:.:..|
Yeast   192 SILGLLGLIVGLLMAGK 208

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Vha16-1NP_476801.1 PRK06558 13..159 CDD:235830 50/146 (34%)
V_ATP_synt_C 15..122 CDD:130170 36/109 (33%)
ATP-synt_C 96..156 CDD:278563 25/60 (42%)
VMA16NP_011891.1 ATP-synt_C 62..121 CDD:306615 18/59 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0636
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.