DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha16-1 and VMA16

DIOPT Version :9

Sequence 1:NP_476801.1 Gene:Vha16-1 / 44307 FlyBaseID:FBgn0262736 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_011891.1 Gene:VMA16 / 856421 SGDID:S000001068 Length:213 Species:Saccharomyces cerevisiae


Alignment Length:147 Identity:51/147 - (34%)
Similarity:80/147 - (54%) Gaps:6/147 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 MGAASAIIFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIYGLVVAVL------ 77
            :|.|..:..|.:|||:|...:|:.:....|..|.:..|::|.::...::|||||::|::      
Yeast    62 LGIALCVGLSVVGAAWGIFITGSSMIGAGVRAPRITTKNLISIIFCEVVAIYGLIIAIVFSSKLT 126

  Fly    78 IAGALEEPSKYSLYRGFIHLGAGLAVGFSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFA 142
            :|.|....||.:||.|:....||:.||.|.|..|.|:||.|.......|....|||.:::|.||.
Yeast   127 VATAENMYSKSNLYTGYSLFWAGITVGASNLICGIAVGITGATAAISDAADSALFVKILVIEIFG 191

  Fly   143 EVLGLYGLIVAIYLYTK 159
            .:|||.||||.:.:..|
Yeast   192 SILGLLGLIVGLLMAGK 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha16-1NP_476801.1 V_ATP_synt_C 15..122 CDD:130170 36/108 (33%)
ATP-synt_Vo_c_ATP6C_rpt2 90..157 CDD:349416 28/66 (42%)
VMA16NP_011891.1 ATP-synt_Vo_c_ATP6F_rpt1 59..121 CDD:349417 18/58 (31%)
ATP-synt_Vo_c_ATP6F_rpt2 141..>192 CDD:349418 19/50 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0636
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.