DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha16-1 and VMA11

DIOPT Version :9

Sequence 1:NP_476801.1 Gene:Vha16-1 / 44307 FlyBaseID:FBgn0262736 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_015090.1 Gene:VMA11 / 855842 SGDID:S000006155 Length:164 Species:Saccharomyces cerevisiae


Alignment Length:161 Identity:100/161 - (62%)
Similarity:128/161 - (79%) Gaps:2/161 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSEVSSD--NPIYGPFFGVMGAASAIIFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVM 63
            ||::::|:  .|:|.||||..|.|:|::.|.||||.||||||.|||.:...:|||||||:|||||
Yeast     1 MSTQLASNIYAPLYAPFFGFAGCAAAMVLSCLGAAIGTAKSGIGIAGIGTFKPELIMKSLIPVVM 65

  Fly    64 AGIIAIYGLVVAVLIAGALEEPSKYSLYRGFIHLGAGLAVGFSGLAAGFAIGIVGDAGVRGTAQQ 128
            :||:|||||||||||||.|.....|:|:.||:||..||.|||:.|::|:|||:|||.|||....|
Yeast    66 SGILAIYGLVVAVLIAGNLSPTEDYTLFNGFMHLSCGLCVGFACLSSGYAIGMVGDVGVRKYMHQ 130

  Fly   129 PRLFVGMILILIFAEVLGLYGLIVAIYLYTK 159
            ||||||::|||||:|||||||:|||:.|.|:
Yeast   131 PRLFVGIVLILIFSEVLGLYGMIVALILNTR 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha16-1NP_476801.1 V_ATP_synt_C 15..122 CDD:130170 67/106 (63%)
ATP-synt_Vo_c_ATP6C_rpt2 90..157 CDD:349416 43/66 (65%)
VMA11NP_015090.1 ATP-synt_C 17..124 CDD:412393 67/106 (63%)
ATP-synt_Vo_c_ATP6C_rpt2 92..159 CDD:349416 43/66 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0636
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53914
OrthoFinder 1 1.000 - - FOG0001101
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100711
Panther 1 1.100 - - O PTHR10263
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X666
TreeFam 1 0.960 - -
87.780

Return to query results.
Submit another query.