DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Vha16-1 and VMA11

Sequence 1:NP_476801.1 Gene:Vha16-1 FlyBaseID:FBgn0262736 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_015090.1 Gene:VMA11 SGDID:S000006155 Length:164 Species:Saccharomyces cerevisiae

Alignment Length:161 Identity:100/162 (62%)
Similarity:128/162 (79%) Gaps:2/162 (1%)


  Fly     1 MSSEVSSD--NPIYGPFFGVMGAASAIIFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVM 63
            ||::::|:  .|:|.||||..|.|:|::.|.||||.||||||.|||.:...:|||||||:|||||
Yeast     1 MSTQLASNIYAPLYAPFFGFAGCAAAMVLSCLGAAIGTAKSGIGIAGIGTFKPELIMKSLIPVVM 65

  Fly    64 AGIIAIYGLVVAVLIAGALEEPSKYSLYRGFIHLGAGLAVGFSGLAAGFAIGIVGDAGVRGTAQQ 128
            :||:|||||||||||||.|.....|:|:.||:||..||.|||:.|::|:|||:|||.|||....|
Yeast    66 SGILAIYGLVVAVLIAGNLSPTEDYTLFNGFMHLSCGLCVGFACLSSGYAIGMVGDVGVRKYMHQ 130

  Fly   129 PRLFVGMILILIFAEVLGLYGLIVAIYLYTK 159
            ||||||::|||||:|||||||:|||:.|.|:
Yeast   131 PRLFVGIVLILIFSEVLGLYGMIVALILNTR 161

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Vha16-1NP_476801.1 PRK06558 13..159 CDD:235830 95/146 (65%)
V_ATP_synt_C 15..122 CDD:130170 68/107 (64%)
ATP-synt_C 96..156 CDD:278563 40/60 (67%)
VMA11NP_015090.1 ATP-synt_C 17..124 CDD:320987 68/107 (64%)
ATP-synt_C 99..158 CDD:306615 39/59 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0636
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126803
Panther 1 1.100 O PTHR10263
Phylome 1 0.910 0.600 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.780

Return to query results.
Submit another query.