DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Vha16-1 and VHA-C3

Sequence 1:NP_476801.1 Gene:Vha16-1 FlyBaseID:FBgn0262736 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_195603.1 Gene:VHA-C3 AraportID:AT4G38920 Length:164 Species:Arabidopsis thaliana

Alignment Length:158 Identity:100/159 (63%)
Similarity:125/159 (79%) Gaps:3/159 (2%)


  Fly     3 SEVSSDNPIYGPFFGVMGAASAIIFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGII 67
            |..|.|..  .||||.:|||:|::||.:||||||||||.|:|:|.||||||:||||:||||||::
plant     2 STFSGDET--APFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVL 64

  Fly    68 AIYGLVVAVLIAGALEEPSK-YSLYRGFIHLGAGLAVGFSGLAAGFAIGIVGDAGVRGTAQQPRL 131
            .||||::||:|:..:...:| |.|:.|:.||.:|||.|.:||:||.|||||||||||..||||:|
plant    65 GIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVRANAQQPKL 129

  Fly   132 FVGMILILIFAEVLGLYGLIVAIYLYTK 159
            ||||||||||||.|.||||||.|.|.::
plant   130 FVGMILILIFAEALALYGLIVGIILSSR 157

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Vha16-1NP_476801.1 PRK06558 13..159 CDD:235830 97/147 (66%)
V_ATP_synt_C 15..122 CDD:130170 68/108 (63%)
ATP-synt_C 96..156 CDD:278563 46/60 (77%)
VHA-C3NP_195603.1 V_ATP_synt_C 12..120 CDD:130170 68/108 (63%)
ATP-synt_C 95..154 CDD:306615 45/59 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 200 1.000 Inparanoid score I1277
OMA 1 1.010
OrthoDB 1 1.010 D1534092at2759
OrthoInspector 1 1.000 T32315
orthoMCL 1 0.900 OOG5_126803
Panther 1 1.100 LDO PTHR10263
Phylome 00.000 Not matched by this tool.
77.070

Return to query results.
Submit another query.