DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Vha16-1 and AT2G16510

Sequence 1:NP_476801.1 Gene:Vha16-1 FlyBaseID:FBgn0262736 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_179244.1 Gene:AT2G16510 AraportID:AT2G16510 Length:164 Species:Arabidopsis thaliana

Alignment Length:158 Identity:100/159 (63%)
Similarity:125/159 (79%) Gaps:3/159 (2%)


  Fly     3 SEVSSDNPIYGPFFGVMGAASAIIFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGII 67
            |..|.|..  .||||.:|||:|::||.:||||||||||.|:|:|.||||||:||||:||||||::
plant     2 STFSGDET--APFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVL 64

  Fly    68 AIYGLVVAVLIAGALEEPSK-YSLYRGFIHLGAGLAVGFSGLAAGFAIGIVGDAGVRGTAQQPRL 131
            .||||::||:|:..:...:| |.|:.|:.||.:|||.|.:||:||.|||||||||||..||||:|
plant    65 GIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAGVRANAQQPKL 129

  Fly   132 FVGMILILIFAEVLGLYGLIVAIYLYTK 159
            ||||||||||||.|.||||||.|.|.::
plant   130 FVGMILILIFAEALALYGLIVGIILSSR 157

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Vha16-1NP_476801.1 PRK06558 13..159 CDD:235830 97/147 (66%)
V_ATP_synt_C 15..122 CDD:130170 68/108 (63%)
ATP-synt_C 96..156 CDD:278563 46/60 (77%)
AT2G16510NP_179244.1 V_ATP_synt_C 12..120 CDD:130170 68/108 (63%)
ATP-synt_C 95..154 CDD:306615 45/59 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126803
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.