DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Vha16-1 and Atp5g2

Sequence 1:NP_476801.1 Gene:Vha16-1 FlyBaseID:FBgn0262736 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_080744.1 Gene:Atp5g2 MGIID:1915192 Length:146 Species:Mus musculus

Alignment Length:119 Identity:34/120 (28%)
Similarity:57/120 (48%) Gaps:27/120 (23%)


  Fly    43 IAAMSVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIAGALEEPSKYSLYRGFIHLGAGLA-VGFS 106
            :::::|.||   :.|:||.......|         |:..::..:|:        :|||.| ||.:
Mouse    46 LSSLAVRRP---LTSLIPSRSFQTSA---------ISRDIDTAAKF--------IGAGAATVGVA 90

  Fly   107 GLAAGFAIGIVGDAGVRGTAQQP----RLFVGMILILIFAEVLGLYGLIVAIYL 156
            |..||  ||.|..:.:.|.|:.|    :||...||....:|.:||:.|:||..:
Mouse    91 GSGAG--IGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLI 142

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Vha16-1NP_476801.1 PRK06558 13..159 CDD:235830 34/120 (28%)
V_ATP_synt_C 15..122 CDD:130170 21/80 (26%)
ATP-synt_C 96..156 CDD:278563 25/65 (38%)
Atp5g2NP_080744.1 ATP9 72..146 CDD:164765 26/82 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0636
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.