DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Vha16-1 and atp6v0b

Sequence 1:NP_476801.1 Gene:Vha16-1 FlyBaseID:FBgn0262736 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_001017064.1 Gene:atp6v0b XenbaseID:XB-GENE-997920 Length:205 Species:Xenopus tropicalis

Alignment Length:149 Identity:52/150 (35%)
Similarity:83/150 (55%) Gaps:8/150 (5%)


  Fly    19 MGAASAIIFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIAGALE 83
            :|...:|..|.:|||:|...:|:.|....|..|.:..|:::.::....:||||:::|::|:...|
 Frog    52 LGIGLSISLSVVGAAWGIYITGSSILGGGVKAPRIKTKNLVSIIFCEAVAIYGIIMAIVISNMAE 116

  Fly    84 E-----P---SKYSLYRGFIHLGAGLAVGFSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILI 140
            :     |   ...:.:.||...||||.||||.|..|..:||||.......||.|.|||.::::.|
 Frog   117 QFKGTTPEAIGSRNYHAGFSMFGAGLTVGFSNLFCGICVGIVGSGAALADAQNPSLFVKILIVEI 181

  Fly   141 FAEVLGLYGLIVAIYLYTK 159
            |...:||:|:||||...:|
 Frog   182 FGSAIGLFGVIVAILQTSK 200

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Vha16-1NP_476801.1 PRK06558 13..159 CDD:235830 51/148 (34%)
V_ATP_synt_C 15..122 CDD:130170 36/111 (32%)
ATP-synt_C 96..156 CDD:278563 29/60 (48%)
atp6v0bNP_001017064.1 ATP-synt_C 52..111 CDD:306615 17/59 (29%)
ATP-synt_C 138..196 CDD:306615 29/58 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0636
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.