DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Vha16-1 and ATP6V0C

Sequence 1:NP_476801.1 Gene:Vha16-1 FlyBaseID:FBgn0262736 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_001185498.1 Gene:ATP6V0C HGNCID:855 Length:155 Species:Homo sapiens

Alignment Length:154 Identity:125/155 (81%)
Similarity:135/155 (87%) Gaps:2/155 (1%)


  Fly     6 SSDNPIYGPFFGVMGAASAIIFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIY 70
            |...|.|..||.||||::|::||||||||||||||||||||||||||.|||||||||||||||||
Human     4 SKSGPEYASFFAVMGASAAMVFSALGAAYGTAKSGTGIAAMSVMRPEQIMKSIIPVVMAGIIAIY 68

  Fly    71 GLVVAVLIAGALEEPSKYSLYRGFIHLGAGLAVGFSGLAAGFAIGIVGDAGVRGTAQQPRLFVGM 135
            |||||||||.:|.:  ..|||:.|:.|||||:||.||||||||||||||||||||||||||||||
Human    69 GLVVAVLIANSLND--DISLYKSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGM 131

  Fly   136 ILILIFAEVLGLYGLIVAIYLYTK 159
            ||||||||||||||||||:.|.||
Human   132 ILILIFAEVLGLYGLIVALILSTK 155

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Vha16-1NP_476801.1 PRK06558 13..159 CDD:235830 121/146 (83%)
V_ATP_synt_C 15..122 CDD:130170 87/107 (81%)
ATP-synt_C 96..156 CDD:278563 55/60 (92%)
ATP6V0CNP_001185498.1 V_ATP_synt_C 13..118 CDD:130170 87/107 (81%)
ATP-synt_C 93..152 CDD:306615 55/59 (93%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C251476205
eggNOG 1 0.900 E1_COG0636
Hieranoid 1 1.000
Homologene 1 1.000 H68199
Inparanoid 1 1.050 233 1.000 Inparanoid score I3369
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1534092at2759
OrthoFinder 1 1.000 FOG0001016
OrthoInspector 1 1.000 T608839
orthoMCL 1 0.900 OOG5_126803
Panther 1 1.100 LDO PTHR10263
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1312.770

Return to query results.
Submit another query.