powered by:
Protein Alignment: Vha16-1 and ATP5MC3
Sequence 1: | NP_476801.1 |
Gene: | Vha16-1 |
FlyBaseID: | FBgn0262736 |
Length: | 159 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001002258.1 |
Gene: | ATP5MC3 |
HGNCID: | 843 |
Length: | 142 |
Species: | Homo sapiens |
Alignment Length: | 65 |
Identity: | 25/66 (38%) |
Similarity: | 36/66 (55%) |
Gaps: | 7/66 (11%) |
Fly 97 LGAGLA-VGFSGLAAGFAIGIVGDAGVRGTAQQP----RLFVGMILILIFAEVLGLYGLIVAIYL 156
:|||.| ||.:|..|| ||.|..:.:.|.|:.| :||...||....:|.:||:.|:||..:
Human 76 IGAGAATVGVAGSGAG--IGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLI 138
Fly 157 156
Human 139 138
|
Known Domains:
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
|
|
|
E1_COG0636 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.